返回首页 在线留言 联系我们
首页 > 产品展示 > > 生化试剂 > 英国biorby 特约全国一级代理1

产品中心

biorby 特约全国一级代理1

  • 型   号:英国
  • 价   格:

上海易汇生物科技有限公司为英国品牌Biorbyt特约代理。负责biorbyt品牌产品在中国市场的推广。为您提供各种biorbyt原装进口产品,主推四大类:一. 抗体 二. 蛋白 三. elisa试剂盒 四. 小分子
biorby 特约全国一级代理1

分享到:

biorby 特约全国一级代理1

biorby 特约全国一级代理1

上海易汇生物科技有限公司为英国品牌Biorbyt特约代理。负责biorbyt品牌产品在中国市场的推广。为您提供各种biorbyt原装进口产品,主推四大类:

一. 抗体(antibody):180000种的一抗。可应用于Western blot,IP,IHC,IF,FACS,ELISA等实验。
二. 蛋白(protien):22000种的高纯度蛋白。
三. elisa试剂盒(elisa kit):可以提供超过16000种的ELISA试剂盒,包括人源,大鼠源,小鼠源等。
四. 小分子(Small Molecules):超过26000种的生物活性小分子,主要包括:拮抗剂、抑制剂、抗生素、天然产物。

所有biorbyt品牌的抗体,蛋白,elisa试剂盒,小分子等产品国际航空低温运输,货期短,多数产品货期在1~2周,快捷便利。
我们为研究者们提供免费的专业的售前售中售后服务,为您的实验保驾护航。

公司对外诚接特色技术外包服务如下:
​重组蛋白表达与纯化服务、单克隆抗体定制服务、多克隆抗体定制服务、免疫学检测服务、动物实验技术服务。我们为客户提供详实的生物信息咨询和*的可行性分析方案,为您的科研项目保驾护航。

上海易汇生物科技有限公司,是一家集研发、销售为一体的高新技术生物企业,公司专注于生命科学和生物技术领域,专业提供分子生物学、免疫学、生命科学基础研究以及临床检测等诸多领域的试剂、耗材、仪器等各类产品及生物技术服务。公司目前已授权代理 LKT Laboratories,Epigentek,Biovision,Abnova等欧美一线品牌,另与阿拉丁,麦克林,TCI等化学试剂生产

商建立了长期合作关系,公司与中科院上海生命科学研究院、上海交通大学、复旦大学和一大批生物医药技术公司建立了长期合作,在综合实力基础上,整合资源效率,打造产学研一体化的

创新平台。公司成立以来与一大批医药集团建立了长期稳定的合作,价格优势、信誉良好。客户包括清华、北大、中科院、上海交通、复旦、国药等等。产品涵盖了试剂、耗材、小型仪器、

原材料等各种实验室使用的材料。
  上海易汇生物科技有限公司拥有强大的采购系统。只要您想得到。没有公司采购办不到的。
  上海易汇生物科技有限公司拥有完善的售后平台。只要有售后。我们第时间为您解决。
  上海易汇生物科技有限公司直接与厂家合作。保证货源正品。购买无后顾之忧。
  上海易汇生物科技有限公司不保证100%价格zui低。但保证100%产品都是正品。
  我们长期与Thermo Bio-rad Axygen qiagen Corning BD Promega Biotium BV targetmol merckmillipore Sigma AAT-Biolite biorbyt ENZO GE Greiner Immonoway Jackson leagene nunc Omega OmnimAbs PMG RD ZOMANBIO 聚仕隆serum 普罗麦格 金钟 Eaivelly阿拉丁,麦克林,TCI LKT Laboratories,Epigentek,Biovision,Abnova Oxoid等知名各大品牌保持合作。

orb256637100 ulCD18 antibodyanti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody, anti 95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD18 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD18. The exact sequence is proprietary.orb248895200 ulCD18 antibodyanti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody5220orb24889550 ulCD18 antibodyanti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody3150orb248895100 ulCD18 antibodyanti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody3600orb443060.1 mgCD18 antibody (Biotin)Anti-CD18 antibody, anti-Integrin beta2 subunit antibody4770orb198087100 TestsCD18 antibody (Biotin)4140orb448290.1 mgCD18 antibody (FITC)Anti-CD18 (mouse) antibody, anti-Integrin beta2 subunit antibody4140orb3018390.5 mlCD18 antibody (FITC)6480orb44307100 testsCD18 antibody (FITC)Anti-CD18 antibody, anti-Integrin beta2 subunit antibody4770orb198086100 TestsCD18 antibody (FITC)4140orb24873650 AssaysCD18 antibody (FITC)anti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody3600orb248736100 AssaysCD18 antibody (FITC)anti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody4770orb1198750 TestsCD18 antibody (FITC)anti-CD18 antibody (FITC)2970orb11987100 TestsCD18 antibody (FITC)anti-CD18 antibody (FITC)3870orb44080100 testsCD18 antibody (PE)Anti-CD18 antibody, anti-Integrin beta2 subunit antibody5670orb44308100 testsCD18 antibody (PE)Anti-CD18 antibody, anti-Integrin beta2 subunit antibody5670orb198138100 TestsCD18 antibody (PE)4590orb301840100 TestsCD18 antibody (PE)8550orb24880950 AssaysCD18 antibody (PE)anti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody4050orb248809100 AssaysCD18 antibody (PE)anti ITGB2 antibody, anti CD18 antibody, anti MFI7 antibody, anti Integrin beta-2 antibody, anti Cell surface adhesion glycoproteins LFA-1/CR3/p150.95 subunit beta antibody, anti Complement receptor C3 subunit beta antibody, anti CD antigen CD18 antibody5940orb1198850 TestsCD18 antibody (PE)anti-CD18 antibody (PE)2970orb11988100 TestsCD18 antibody (PE)anti-CD18 antibody (PE)4050orb447110.1 mgCD180 antibodyAnti-CD180 antibody4590orb2236350.1 mgCD180 antibody3690Human tonsillar B cellsorb3023870.2 mgCD180 antibody11880orb311534100 ulCD180 antibody4716KLH Conjugated synthetic peptideorb335124100 ulCD180 antibody3798A synthesized peptideorb33512450 ulCD180 antibody3258A synthesized peptideorb362102200 ugCD180 antibody6030Recombinant mouse CD180/RP105 protein orb36210250 ugCD180 antibody3420Recombinant mouse CD180/RP105 protein orb362102100 ugCD180 antibody4680Recombinant mouse CD180/RP105 protein orb304714200 ulCD180 antibodyanti LY64 antibody, anti RP105 antibody, anti CD180 antigen antibody, anti Lymphocyte antigen 64 antibody, anti Radioprotective 105 kDa protein antibody, anti CD180 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD180. The exact sequence is proprietary.orb304714100 ulCD180 antibodyanti LY64 antibody, anti RP105 antibody, anti CD180 antigen antibody, anti Lymphocyte antigen 64 antibody, anti Radioprotective 105 kDa protein antibody, anti CD180 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD180. The exact sequence is proprietary.orb36121250 ugCD180 antibody4050Recombinant mouse CD180/RP105 Protein orb361212100 ugCD180 antibody6030Recombinant mouse CD180/RP105 Protein orb33503350 ulCD180 antibodyanti CD180 antibody, anti CD180 antigen antibody, anti Lymphocyte antigen 64 antibody, anti Ly78 antibody, anti LY64 antibody, anti CD180 molecule antibody, anti RP105 antibody6660Synthetic peptideorb4131350 ulCD180 antibody2520Recombinant human CD180 antigen proteinorb41313100 ulCD180 antibody3420Recombinant human CD180 antigen proteinorb154439100 TestsCD180 antibody (APC)5670Human tonsillar B cellsorb3023880.1 mgCD180 antibody (FITC)9090orb44712100 testsCD180 antibody (PE)Anti-CD180 antibody5670orb229920200 ugCD183 antibody6030orb22992050 ugCD183 antibody3420orb229920100 ugCD183 antibody4680orb371619100 ugCD184 antibody3690CP-MAC-infected Sup-T1 cellsorb113026100 ulCD184 antibody (APC)CD184 antibody (APC), Chemokine CXC Motif Receptor 4 antibody (APC), CXCR4 antibody (APC), D2S201E antibody (APC), FB22 antibody (APC), Fusin antibody (APC), HM89 antibody (APC), HSY3RR antibody (APC), LAP3 antibody (APC), LCR1 antibody (APC), LESTR antibody (APC), Leukocyte-derived seven transmembrane domain receptor a antibody (APC), NPY3R antibody (APC), NPYR antibody (APC), NPYRL antibody (APC), NPYY3R antibody (APC), WHIM antibody (APC)3870Synthetic peptide (Please contact us for more details)orb381896100 ugCD184/CXCR4 antibody2970orb381896200 ugCD184/CXCR4 antibody3870orb256484200 ulCD186 antibodyanti BONZO antibody, anti STRL33 antibody, anti TYMSTR antibody, anti C-X-C chemokine receptor type 6 antibody, anti CXC-R6 antibody, anti CXCR-6 antibody, anti CDw186 antibody, anti G-protein coupled receptor STRL33 antibody, anti G-protein coupled receptor bonzo antibody, anti CD186 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the N-term region of human CD186. The exact sequence is proprietary.orb256484100 ulCD186 antibodyanti BONZO antibody, anti STRL33 antibody, anti TYMSTR antibody, anti C-X-C chemokine receptor type 6 antibody, anti CXC-R6 antibody, anti CXCR-6 antibody, anti CDw186 antibody, anti G-protein coupled receptor STRL33 antibody, anti G-protein coupled receptor bonzo antibody, anti CD186 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the N-term region of human CD186. The exact sequence is proprietary.orb38567520 ugCD19 (B-lymphocyte marker) antibody3960Human CD19 recombinant protein was used as immunogen for this CD19 antibody.orb385675100 ugCD19 (B-lymphocyte marker) antibody5850Human CD19 recombinant protein was used as immunogen for this CD19 antibody.orb193043100 ulCD19 (phospho-531) antibodyanti B-lymphocyte surface antigen B4 antibody, anti CD19 antibody, anti Leu-12 antibody4716Synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-Y(p)-E-N).orb336127100 ulCD19 (Phospho-Tyr500) antibody3798A synthesized peptide derived from human CD19 (Phospho-Tyr500)orb33612750 ulCD19 (Phospho-Tyr500) antibody3258A synthesized peptide derived from human CD19 (Phospho-Tyr500)orb106064100 ugCD19 (phospho-Tyr531) antibodyanti-CD19 (phospho-Tyr531) antibody, anti-Antibody deficiency due to defect in CD19, included antibody, anti-AW495831 antibody, anti-B lymphocyte antigen CD19 antibody, anti-B lymphocyte surface antigen B4 antibody, anti-B4 antibody, anti-CD 19 antibody, anti-CD19 antigen antibody, anti-CD19 molecule antibody, anti-Cd19 protein antibody, anti-Differentiation Antigen CD19 antibody, anti-Leu 12 antibody, anti-Leu12 antibody, anti-Lymphocyte Surface Antigen antibody, anti-MGC109570 antibody, anti-MGC12802 antibody, anti-T-cell surface antigen Leu-12 antibody3870KLH conjugated synthetic phosphopeptide derived from human CD19 around the phosphorylation site of Tyr531. Please contact us for the exact immunogen sequence.orb191698100 ulCD19 (Phospho-Tyr531) antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti CD19 antibody, anti CD19 molecule antibody, anti MGC12802 antibody4716Peptide sequence around phosphorylation site of tyrosine 531 (D-S-Y(p)-E-N) derived from Human CD19.orb578950 ulCD19 (Phospho-Tyr531) antibodyantiB-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Differentiation antigen CD19 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody3258A synthesized peptide derived from human CD19 (Phospho-Tyr531)orb5789100 ulCD19 (Phospho-Tyr531) antibodyantiB-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Differentiation antigen CD19 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody3798A synthesized peptide derived from human CD19 (Phospho-Tyr531)orb8637100 ugCD19 (phospho-Tyr531) antibody (FITC)anti-CD19 (phospho-Tyr531) antibody, anti-Antibody deficiency due to defect in CD19, included antibody, anti-AW495831 antibody, anti-B lymphocyte antigen CD19 antibody, anti-B lymphocyte surface antigen B4 antibody, anti-B4 antibody, anti-CD 19 antibody, anti-CD19 antigen antibody, anti-CD19 molecule antibody, anti-Cd19 protein antibody, anti-Differentiation Antigen CD19 antibody, anti-Leu 12 antibody, anti-Leu12 antibody, anti-Lymphocyte Surface Antigen antibody, anti-MGC109570 antibody, anti-MGC12802 antibody, anti-T-cell surface antigen Leu-12 antibody3870Please contact us for the exact immunogen sequence.orb213689200 ulCD19 (phospho-Y531) antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD19 antibody5040orb213689100 ulCD19 (phospho-Y531) antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD19 antibody3420orb439190.1 mgCD19 antibodyAnti-CD19 antibody3690orb446600.1 mgCD19 antibodyAnti-CD19 antibody3690orb447940.1 mgCD19 antibodyAnti-CD19 (mouse) antibody3330orb2335940.1 mgCD19 antibody3330"Mouse CD19-transfected cell line"orb3019180.1 mgCD19 antibody5850orb265070.2 mgCD19 antibodyCD19, Pan B-Cells, Anti-CD19, Pan B-Cells antibody, anti-CD19, Pan B-Cells Primary antibodies, anti-MAb to CD19 antibody, CD19, Pan B-Cells Primary antibodies, CD19, Pan B-Cells is a monoclonal antibody to human cds.7542SKLY 18 Lymphoma Cellsorb3027230.2 mgCD19 antibody12780orb3017991 mlCD19 antibody6480orb3021351 mlCD19 antibody18450orb107679100 ugCD19 antibodyanti CD19 antibody 4500internal regionorb153340100 ugCD19 antibodyanti B4 antibody, anti Bgp95 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti CVID3 antibody, anti differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody2970Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli.orb160312100 ugCD19 antibody2970Synthesized peptide derived from human CD19 around the non-phosphorylation site of Y531.orb195299100 ugCD19 antibody4716orb198034100 ugCD19 antibody3600orb334532100 ugCD19 antibodyanti CD19 antibody, anti Antibody deficiency due to defect in CD19, included antibody, anti AW495831 antibody, anti B lymphocyte antigen CD19 antibody, anti B lymphocyte surface antigen B4 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Cd19 protein antibody, anti CD19_HUMAN antibody, anti CVID3 antibody, anti Differentiation antigen CD19 antibody, anti Leu 12 antibody, anti Leu-12 antibody, anti Leu12 antibody, anti MGC109570 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody4860A synthetic peptide corresponding to a sequence in the middle region of human CD19orb334954100 ugCD19 antibodyAnti-B4 antibody, Anti-Bgp95 antibody, Anti-B-lymphocyte antigen CD19 antibody, Anti-B-lymphocyte surface antigen B4 antibody, Anti-CVID3 antibody, Anti-differentiation antigen CD19 antibody, Anti-T-cell surface antigen Leu-12 antibody.2970Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli.orb348852100 ugCD19 antibody3870Recombinant proteinorb348854100 ugCD19 antibody3870Recombinant proteinorb348877100 ugCD19 antibody3870Recombinant proteinorb348911100 ugCD19 antibody3870Recombinant proteinorb348913100 ugCD19 antibody3870Recombinant proteinorb348921100 ugCD19 antibody3870Recombinant proteinorb388868100 ugCD19 antibody4356Recombinant human CD19 proteinorb388869100 ugCD19 antibody4356Recombinant human CD19 proteinorb388870100 ugCD19 antibody4356Recombinant human CD19 proteinorb10306100 ugCD19 antibodyanti-Cluster Of Differentiation 19 antibody, anti-AW495831 antibody, anti-B lymphocytegen CD19 antibody, anti-B lymphocyte surfacegen B4 antibody, anti-B4 antibody, anti-CD19 antibody, anti-CD19gen antibody, anti-CD19 molecule antibody, anti-Cd19 proteinbod antibody, anti-deficiency due to defect in CD19 antibody, anti-Differentiationgen CD19 antibody, anti-included antibody, anti-LEU-12 antibody, anti-Lymphocyte Surfacegen antibody, anti-MGC12802 antibody3330orb10306200 ugCD19 antibodyanti-Cluster Of Differentiation 19 antibody, anti-AW495831 antibody, anti-B lymphocytegen CD19 antibody, anti-B lymphocyte surfacegen B4 antibody, anti-B4 antibody, anti-CD19 antibody, anti-CD19gen antibody, anti-CD19 molecule antibody, anti-Cd19 proteinbod antibody, anti-deficiency due to defect in CD19 antibody, anti-Differentiationgen CD19 antibody, anti-included antibody, anti-LEU-12 antibody, anti-Lymphocyte Surfacegen antibody, anti-MGC12802 antibody4500orb1699100 ugCD19 antibodyanti CD19 antibody3330Synthetic peptide (please contact us for details)orb1699200 ugCD19 antibodyanti CD19 antibody4500Synthetic peptide (please contact us for details)orb156300100 ugCD19 antibodyanti-B lymphocyte antigen CD19 antibody, anti-B lymphocyte surface antigen B4 antibody, anti-B4 antibody, anti-CD 19 antibody, anti-CD19 antigen antibody, anti-CD19 molecule antibody, anti-Cd19 protein antibody, anti-Dferentiation Antigen CD19 antibody, anti-Leu 12 antibody, anti-Leu12 antibody, anti-Lymphocyte Surface Antigen antibody, anti-MGC109570 antibody, anti-MGC12802 antibody, anti-T-cell surface antigen Leu-12 antibody2970KLH conjugated synthetic peptide derived from dog CD19orb156300200 ugCD19 antibodyanti-B lymphocyte antigen CD19 antibody, anti-B lymphocyte surface antigen B4 antibody, anti-B4 antibody, anti-CD 19 antibody, anti-CD19 antigen antibody, anti-CD19 molecule antibody, anti-Cd19 protein antibody, anti-Dferentiation Antigen CD19 antibody, anti-Leu 12 antibody, anti-Leu12 antibody, anti-Lymphocyte Surface Antigen antibody, anti-MGC109570 antibody, anti-MGC12802 antibody, anti-T-cell surface antigen Leu-12 antibody3870KLH conjugated synthetic peptide derived from dog CD19orb251482100 ugCD19 antibodyanti-Cluster Of Differentiation 19 antibody, anti-AW495831 antibody, anti-B lymphocytegen CD19 antibody, anti-B lymphocyte surfacegen B4 antibody, anti-B4 antibody, anti-CD19 antibody, anti-CD19gen antibody, anti-CD19 molecule antibody, anti-Cd19 proteinbod antibody, anti-deficiency due to defect in CD19 antibody, anti-Differentiationgen CD19 antibody, anti-included antibody, anti-LEU-12 antibody, anti-Lymphocyte Surfacegen antibody, anti-MGC12802 antibody2970orb251482200 ugCD19 antibodyanti-Cluster Of Differentiation 19 antibody, anti-AW495831 antibody, anti-B lymphocytegen CD19 antibody, anti-B lymphocyte surfacegen B4 antibody, anti-B4 antibody, anti-CD19 antibody, anti-CD19gen antibody, anti-CD19 molecule antibody, anti-Cd19 proteinbod antibody, anti-deficiency due to defect in CD19 antibody, anti-Differentiationgen CD19 antibody, anti-included antibody, anti-LEU-12 antibody, anti-Lymphocyte Surfacegen antibody, anti-MGC12802 antibody3870orb317567100 ugCD19 antibodyanti Antibody deficiency due to defect in CD19 antibody, anti included antibody, anti AW495831 antibody, anti B lymphocyte antigen CD19 antibody, anti B lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD 19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Cd19 protein antibody, anti Differentiation Antigen CD19 antibody, anti Leu 12 antibody, anti Leu12 antibody, anti Lymphocyte Surface Antigen antibody, anti MGC109570 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody3330KLH conjugated synthetic peptide derived from human CD19 (485-526aa)orb317567200 ugCD19 antibodyanti Antibody deficiency due to defect in CD19 antibody, anti included antibody, anti AW495831 antibody, anti B lymphocyte antigen CD19 antibody, anti B lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD 19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Cd19 protein antibody, anti Differentiation Antigen CD19 antibody, anti Leu 12 antibody, anti Leu12 antibody, anti Lymphocyte Surface Antigen antibody, anti MGC109570 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody4500KLH conjugated synthetic peptide derived from human CD19 (485-526aa)orb126667100 ugCD19 antibody2880Synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-YP-E-N).orb126667200 ugCD19 antibody4140Synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-YP-E-N).orb11989100 ugCD19 antibodyanti-CD19 antibody2700orb11989500 ugCD19 antibodyanti-CD19 antibody5040orb69255100 ulCD19 antibodyanti B4 antibody, anti MGC12802 antibody3960Purified recombinant fragment of human CD19 expressed in E. Coli.orb153358100 ulCD19 antibodyanti B4 antibody, anti MGC12802 antibody3960Purified recombinant fragment of human CD19 expressed in E. Coli.orb192640100 ulCD19 antibodyanti B4 antibody, anti CVID3 antibody4716Recombinant protein of human CD19.orb195838100 ulCD19 antibody4230orb311487100 ulCD19 antibody4716KLH Conjugated synthetic peptideorb378640100 ulCD19 antibody4230Recombinant proteinorb394446100 ulCD19 antibody3798Recombinant fragment of human CD19 expressed in E. Coliorb39444650 ulCD19 antibody3258Recombinant fragment of human CD19 expressed in E. Coliorb229165100 ulCD19 antibodyanti B4 antibody, anti CVID3 antibody, anti antibody3798Recombinant protein of human CD19orb22916520 ulCD19 antibodyanti B4 antibody, anti CVID3 antibody, anti antibody2736Recombinant protein of human CD19orb22916550 ulCD19 antibodyanti B4 antibody, anti CVID3 antibody, anti antibody3258Recombinant protein of human CD19orb43923100 testsCD19 antibodyAnti-CD19 antibody5670orb44663100 testsCD19 antibodyAnti-CD19 antibody5670orb5607920 ugCD19 antibody3960Human CD19 recombinant protein was used as immunogen for this anti-CD19 antibody.orb56079100 ugCD19 antibody5850Human CD19 recombinant protein was used as immunogen for this anti-CD19 antibody.orb5608020 ugCD19 antibody3960Human CD19 recombinant protein was used as immunogen for this CD19 antibody.orb56080100 ugCD19 antibody5850Human CD19 recombinant protein was used as immunogen for this CD19 antibody.orb99338100 ulCD19 antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Differentiation antigen CD19 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody3798A synthesized peptide derived from human CD19orb9933850 ulCD19 antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Differentiation antigen CD19 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody3258A synthesized peptide derived from human CD19orb308448200 ugCD19 antibodyanti CD19 antibody3780Chronic Lymphoid Leukaemia (CLL) cellsorb362267200 ugCD19 antibody6030orb36226750 ugCD19 antibody3420orb362267100 ugCD19 antibody4680orb89008200 ulCD19 antibody6660orb339126200 ulCD19 antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD19 antibody4320orb339126100 ulCD19 antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD19 antibody3870orb248896200 ulCD19 antibodyanti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody5220orb24889650 ulCD19 antibodyanti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody3150orb248896100 ulCD19 antibodyanti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody3600orb390282200 ulCD19 antibody6480Recombinant protein of human CD19orb39028250 ulCD19 antibody3060Recombinant protein of human CD19orb390282100 ulCD19 antibody4140Recombinant protein of human CD19orb308450200 TestsCD19 antibodyanti CD19 antibody3780Chronic Lymphoid Leukaemia (CLL) cellsorb375903300 ugCD19 antibody6660Recombinant proteinorb230727400 ugCD19 antibody6030orb230727100 ugCD19 antibody3420orb230727200 ugCD19 antibody4680orb33193400 ulCD19 antibodyAnti-B-lymphocyte antigen CD19 antibody, anti-Differentiation antigen CD19 antibody, anti-B-lymphocyte surface antigen B4 antibody, anti-Leu-12 antibody4050This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-421 amino acids from the C-terminal region of human CD19.orb306054400 ulCD19 antibodyanti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD19 antibody, anti CD19 antibody4050This CD19 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 517-551 amino acids from the C-terminal region of human CD19.orb23072650 ugCD19 antibody4050orb230726100 ugCD19 antibody6030orb36071450 ulCD19 antibody6660Recombinant proteinorb111550100 ulCD19 antibody (Alexa 488)Cluster Of Differentiation 19 antibody (Alexa 488), AW495831 antibody (Alexa 488), B lymphocytegen CD19 antibody (Alexa 488), B lymphocyte surfacegen B4 antibody (Alexa 488), B4 antibody (Alexa 488), CD19 antibody (Alexa 488), CD19gen antibody (Alexa 488), CD19 molecule antibody (Alexa 488), Cd19 proteinbod antibody (Alexa 488), deficiency due to defect in CD19 antibody (Alexa 488), Differentiationgen CD19 antibody (Alexa 488), included antibody (Alexa 488), LEU-12 antibody (Alexa 488), Lymphocyte Surfacegen antibody (Alexa 488), MGC12802 antibody (Alexa 488)3870Synthetic peptide (Please contact us for more details)orb111058100 ulCD19 antibody (Alexa Fluor 350)Cluster Of Differentiation 19 antibody (Alexa Fluor 350), AW495831 antibody (Alexa Fluor 350), B lymphocytegen CD19 antibody (Alexa Fluor 350), B lymphocyte surfacegen B4 antibody (Alexa Fluor 350), B4 antibody (Alexa Fluor 350), CD19 antibody (Alexa Fluor 350), CD19gen antibody (Alexa Fluor 350), CD19 molecule antibody (Alexa Fluor 350), Cd19 proteinbod antibody (Alexa Fluor 350), deficiency due to defect in CD19 antibody (Alexa Fluor 350), Differentiationgen CD19 antibody (Alexa Fluor 350), included antibody (Alexa Fluor 350), LEU-12 antibody (Alexa Fluor 350), Lymphocyte Surfacegen antibody (Alexa Fluor 350), MGC12802 antibody (Alexa Fluor 350)3870Synthetic peptide (Please contact us for more details)orb113519100 ulCD19 antibody (Alkaline Phosphatase)Cluster Of Differentiation 19 antibody (Alkaline Phosphatase), AW495831 antibody (Alkaline Phosphatase), B lymphocytegen CD19 antibody (Alkaline Phosphatase), B lymphocyte surfacegen B4 antibody (Alkaline Phosphatase), B4 antibody (Alkaline Phosphatase), CD19 antibody (Alkaline Phosphatase), CD19gen antibody (Alkaline Phosphatase), CD19 molecule antibody (Alkaline Phosphatase), Cd19 proteinbod antibody (Alkaline Phosphatase), deficiency due to defect in CD19 antibody (Alkaline Phosphatase), Differentiationgen CD19 antibody (Alkaline Phosphatase), included antibody (Alkaline Phosphatase), LEU-12 antibody (Alkaline Phosphatase), Lymphocyte Surfacegen antibody (Alkaline Phosphatase), MGC12802 antibody (Alkaline Phosphatase)3870Synthetic peptide (Please contact us for more details)orb198252100 TestsCD19 antibody (APC)5670orb24871050 AssaysCD19 antibody (APC)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody3600orb248710100 AssaysCD19 antibody (APC)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody4770orb19526450 TestsCD19 antibody (APC)4716orb1199350 TestsCD19 antibody (APC)anti-CD19 antibody (APC)2970orb11993100 TestsCD19 antibody (APC)anti-CD19 antibody (APC)4050orb439200.1 mgCD19 antibody (Biotin)Anti-CD19 antibody4770orb1544670.1 mgCD19 antibody (Biotin)4770Human CCL (chronic lymphocytic leukemia) cells orb3019160.1 mgCD19 antibody (Biotin)7110orb11995100 ugCD19 antibody (Biotin)anti-CD19 antibody (Biotin)2970orb11995500 ugCD19 antibody (Biotin)anti-CD19 antibody (Biotin)6570orb114012100 ulCD19 antibody (Biotin)Cluster Of Differentiation 19 antibody (Biotin), AW495831 antibody (Biotin), B lymphocytegen CD19 antibody (Biotin), B lymphocyte surfacegen B4 antibody (Biotin), B4 antibody (Biotin), CD19 antibody (Biotin), CD19gen antibody (Biotin), CD19 molecule antibody (Biotin), Cd19 proteinbod antibody (Biotin), deficiency due to defect in CD19 antibody (Biotin), Differentiationgen CD19 antibody (Biotin), included antibody (Biotin), LEU-12 antibody (Biotin), Lymphocyte Surfacegen antibody (Biotin), MGC12802 antibody (Biotin)3870Synthetic peptide (Please contact us for more details)orb198089100 TestsCD19 antibody (Biotin)4140orb308451100 TestsCD19 antibody (Biotin)anti CD19 antibody3780Chronic Lymphoid Leukaemia (CLL) cellsorb24869850 AssaysCD19 antibody (Biotin)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody3600orb248698100 AssaysCD19 antibody (Biotin)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody4770orb19526550 TestsCD19 antibody (Biotin)4716orb114504100 ulCD19 antibody (Cy3)Cluster Of Differentiation 19 antibody (Cy3), AW495831 antibody (Cy3), B lymphocytegen CD19 antibody (Cy3), B lymphocyte surfacegen B4 antibody (Cy3), B4 antibody (Cy3), CD19 antibody (Cy3), CD19gen antibody (Cy3), CD19 molecule antibody (Cy3), Cd19 proteinbod antibody (Cy3), deficiency due to defect in CD19 antibody (Cy3), Differentiationgen CD19 antibody (Cy3), included antibody (Cy3), LEU-12 antibody (Cy3), Lymphocyte Surfacegen antibody (Cy3), MGC12802 antibody (Cy3)3870Synthetic peptide (Please contact us for more details)orb114996100 ulCD19 antibody (Cy5)Cluster Of Differentiation 19 antibody (Cy5), AW495831 antibody (Cy5), B lymphocytegen CD19 antibody (Cy5), B lymphocyte surfacegen B4 antibody (Cy5), B4 antibody (Cy5), CD19 antibody (Cy5), CD19gen antibody (Cy5), CD19 molecule antibody (Cy5), Cd19 proteinbod antibody (Cy5), deficiency due to defect in CD19 antibody (Cy5), Differentiationgen CD19 antibody (Cy5), included antibody (Cy5), LEU-12 antibody (Cy5), Lymphocyte Surfacegen antibody (Cy5), MGC12802 antibody (Cy5)3870Synthetic peptide (Please contact us for more details)orb19800550 TestsCD19 antibody (Cy5, PE)3150orb123037100 ulCD19 antibody (Cy5.5)Cluster Of Differentiation 19 antibody (Cy5.5), AW495831 antibody (Cy5.5), B lymphocytegen CD19 antibody (Cy5.5), B lymphocyte surfacegen B4 antibody (Cy5.5), B4 antibody (Cy5.5), CD19 antibody (Cy5.5), CD19gen antibody (Cy5.5), CD19 molecule antibody (Cy5.5), Cd19 proteinbod antibody (Cy5.5), deficiency due to defect in CD19 antibody (Cy5.5), Differentiationgen CD19 antibody (Cy5.5), included antibody (Cy5.5), LEU-12 antibody (Cy5.5), Lymphocyte Surfacegen antibody (Cy5.5), MGC12802 antibody (Cy5.5)3870Synthetic peptide (Please contact us for more details)orb123529100 ulCD19 antibody (Cy7)Cluster Of Differentiation 19 antibody (Cy7), AW495831 antibody (Cy7), B lymphocytegen CD19 antibody (Cy7), B lymphocyte surfacegen B4 antibody (Cy7), B4 antibody (Cy7), CD19 antibody (Cy7), CD19gen antibody (Cy7), CD19 molecule antibody (Cy7), Cd19 proteinbod antibody (Cy7), deficiency due to defect in CD19 antibody (Cy7), Differentiationgen CD19 antibody (Cy7), included antibody (Cy7), LEU-12 antibody (Cy7), Lymphocyte Surfacegen antibody (Cy7), MGC12802 antibody (Cy7)3870Synthetic peptide (Please contact us for more details)orb154548100 TestsCD19 antibody (DyLight 594)6300Human CCL (chronic lymphocytic leukemia) cells orb3019170.1 mgCD19 antibody (FITC)7110orb3019050.5 mlCD19 antibody (FITC)6390orb15283100 ugCD19 antibody (FITC)anti-Cluster Of Differentiation 19 antibody, anti-AW495831 antibody, anti-B lymphocytegen CD19 antibody, anti-B lymphocyte surfacegen B4 antibody, anti-B4 antibody, anti-CD19 antibody, anti-CD19gen antibody, anti-CD19 molecule antibody, anti-Cd19 proteinbod antibody, anti-deficiency due to defect in CD19 antibody, anti-Differentiationgen CD19 antibody, anti-included antibody, anti-LEU-12 antibody, anti-Lymphocyte Surfacegen antibody, anti-MGC12802 antibody3870Synthetic peptide (please contact us for details)orb3729100 ugCD19 antibody (FITC)anti CD19 antibody (FITC)3870Synthetic peptide (please contact us for details)orb318078100 ugCD19 antibody (FITC)anti Antibody deficiency due to defect in CD19 antibody, anti included antibody, anti AW495831 antibody, anti B lymphocyte antigen CD19 antibody, anti B lymphocyte surface antigen B4 antibody, anti B4 antibody, anti CD 19 antibody, anti CD19 antigen antibody, anti CD19 molecule antibody, anti Cd19 protein antibody, anti Differentiation Antigen CD19 antibody, anti Leu 12 antibody, anti Leu12 antibody, anti Lymphocyte Surface Antigen antibody, anti MGC109570 antibody, anti MGC12802 antibody, anti T-cell surface antigen Leu-12 antibody3870KLH conjugated synthetic peptide derived from human CD19 (485-526aa)orb360780100 ugCD19 antibody (FITC)anti-Cluster Of Differentiation 19 antibody, anti-AW495831 antibody, anti-B lymphocytegen CD19 antibody, anti-B lymphocyte surfacegen B4 antibody, anti-B4 antibody, anti-CD19 antibody, anti-CD19gen antibody, anti-CD19 molecule antibody, anti-Cd19 proteinbod antibody, anti-deficiency due to defect in CD19 antibody, anti-Differentiationgen CD19 antibody, anti-included antibody, anti-LEU-12 antibody, anti-Lymphocyte Surfacegen antibody, anti-MGC12802 antibody3330Synthetic peptide (please contact us for details)orb43921100 testsCD19 antibody (FITC)Anti-CD19 antibody4770orb44661100 testsCD19 antibody (FITC)Anti-CD19 antibody4770orb198088100 TestsCD19 antibody (FITC)4140orb308449100 TestsCD19 antibody (FITC)anti CD19 antibody3780Chronic Lymphoid Leukaemia (CLL) cellsorb24873750 AssaysCD19 antibody (FITC)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody3600orb248737100 AssaysCD19 antibody (FITC)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody4770orb36131950 TestCD19 antibody (FITC)4050Recombinant human CD19 Protein orb361319100 TestCD19 antibody (FITC)6030Recombinant human CD19 Protein orb19526150 TestsCD19 antibody (FITC)4716orb1199050 TestsCD19 antibody (FITC)anti-CD19 antibody (FITC)2970orb11990100 TestsCD19 antibody (FITC)anti-CD19 antibody (FITC)3870orb198271100 TestsCD19 antibody (FITC, PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb19815150 TestsCD19 antibody (FITC, PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb19528420 TestsCD19 antibody (FITC/PE)4716orb1215620 TestsCD19 antibody (FITC/PE)anti-CD3/CD19 antibody (FITC/PE)2700orb1215650 TestsCD19 antibody (FITC/PE)anti-CD3/CD19 antibody (FITC/PE)4140orb19529020 TestsCD19 antibody (FITC/PE/Cy5)4716orb110072100 ulCD19 antibody (HRP)Cluster Of Differentiation 19 antibody (HRP), AW495831 antibody (HRP), B lymphocytegen CD19 antibody (HRP), B lymphocyte surfacegen B4 antibody (HRP), B4 antibody (HRP), CD19 antibody (HRP), CD19gen antibody (HRP), CD19 molecule antibody (HRP), Cd19 proteinbod antibody (HRP), deficiency due to defect in CD19 antibody (HRP), Differentiationgen CD19 antibody (HRP), included antibody (HRP), LEU-12 antibody (HRP), Lymphocyte Surfacegen antibody (HRP), MGC12802 antibody (HRP)3870Synthetic peptide (Please contact us for more details)orb447950.1 mgCD19 antibody (PE)Anti-CD19 (mouse) antibody4410orb3019190.1 mgCD19 antibody (PE)8550orb124513100 ulCD19 antibody (PE)Cluster Of Differentiation 19 antibody (PE), AW495831 antibody (PE), B lymphocytegen CD19 antibody (PE), B lymphocyte surfacegen B4 antibody (PE), B4 antibody (PE), CD19 antibody (PE), CD19gen antibody (PE), CD19 molecule antibody (PE), Cd19 proteinbod antibody (PE), deficiency due to defect in CD19 antibody (PE), Differentiationgen CD19 antibody (PE), included antibody (PE), LEU-12 antibody (PE), Lymphocyte Surfacegen antibody (PE), MGC12802 antibody (PE)3870Synthetic peptide (Please contact us for more details)orb43922100 testsCD19 antibody (PE)Anti-CD19 antibody5670orb44662100 testsCD19 antibody (PE)Anti-CD19 antibody5670orb198139100 TestsCD19 antibody (PE)4590orb198229100 TestsCD19 antibody (PE)5040orb308702100 TestsCD19 antibody (PE)anti CD19 antibody4230Chronic Lymphoid Leukemia cells (CLL)orb24881050 AssaysCD19 antibody (PE)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody3600orb248810100 AssaysCD19 antibody (PE)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody4770orb36132050 TestCD19 antibody (PE)4050Recombinant human CD19 Protein orb361320100 TestCD19 antibody (PE)6030Recombinant human CD19 Protein orb19526250 TestsCD19 antibody (PE)4716orb1199150 TestsCD19 antibody (PE)anti-CD19 antibody (PE)2970orb11991100 TestsCD19 antibody (PE)anti-CD19 antibody (PE)4050orb387902100 TestsCD19 antibody (PE/DyLight 594)6300Daudi human Burkitt lymphoma cell lineorb125290100 ulCD19 antibody (PE-Cy3)Cluster Of Differentiation 19 antibody (PE-Cy3), AW495831 antibody (PE-Cy3), B lymphocytegen CD19 antibody (PE-Cy3), B lymphocyte surfacegen B4 antibody (PE-Cy3), B4 antibody (PE-Cy3), CD19 antibody (PE-Cy3), CD19gen antibody (PE-Cy3), CD19 molecule antibody (PE-Cy3), Cd19 proteinbod antibody (PE-Cy3), deficiency due to defect in CD19 antibody (PE-Cy3), Differentiationgen CD19 antibody (PE-Cy3), included antibody (PE-Cy3), LEU-12 antibody (PE-Cy3), Lymphocyte Surfacegen antibody (PE-Cy3), MGC12802 antibody (PE-Cy3)3870Synthetic peptide (Please contact us for more details)orb129792100 ulCD19 antibody (PE-Cy5)Cluster Of Differentiation 19 antibody (PE-Cy5), AW495831 antibody (PE-Cy5), B lymphocytegen CD19 antibody (PE-Cy5), B lymphocyte surfacegen B4 antibody (PE-Cy5), B4 antibody (PE-Cy5), CD19 antibody (PE-Cy5), CD19gen antibody (PE-Cy5), CD19 molecule antibody (PE-Cy5), Cd19 proteinbod antibody (PE-Cy5), deficiency due to defect in CD19 antibody (PE-Cy5), Differentiationgen CD19 antibody (PE-Cy5), included antibody (PE-Cy5), LEU-12 antibody (PE-Cy5), Lymphocyte Surfacegen antibody (PE-Cy5), MGC12802 antibody (PE-Cy5)3870Synthetic peptide (Please contact us for more details)orb24886450 AssaysCD19 antibody (PE-Cy5)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody4050orb248864100 AssaysCD19 antibody (PE-Cy5)anti CD19 antibody, anti B-lymphocyte antigen CD19 antibody, anti B-lymphocyte surface antigen B4 antibody, anti Differentiation antigen CD19 antibody, anti T-cell surface antigen Leu-12 antibody, anti CD antigen CD19 antibody5940orb19526350 TestsCD19 antibody (PE-Cy5)4716orb1199250 TestsCD19 antibody (PE-Cy5)anti-CD19 antibody (PE-Cy5)3330orb11992100 TestsCD19 antibody (PE-Cy5)anti-CD19 antibody (PE-Cy5)4410orb130284100 ulCD19 antibody (PE-Cy5.5)Cluster Of Differentiation 19 antibody (PE-Cy5.5), AW495831 antibody (PE-Cy5.5), B lymphocytegen CD19 antibody (PE-Cy5.5), B lymphocyte surfacegen B4 antibody (PE-Cy5.5), B4 antibody (PE-Cy5.5), CD19 antibody (PE-Cy5.5), CD19gen antibody (PE-Cy5.5), CD19 molecule antibody (PE-Cy5.5), Cd19 proteinbod antibody (PE-Cy5.5), deficiency due to defect in CD19 antibody (PE-Cy5.5), Differentiationgen CD19 antibody (PE-Cy5.5), included antibody (PE-Cy5.5), LEU-12 antibody (PE-Cy5.5), Lymphocyte Surfacegen antibody (PE-Cy5.5), MGC12802 antibody (PE-Cy5.5)3870Synthetic peptide (Please contact us for more details)orb130776100 ulCD19 antibody (PE-Cy7)Cluster Of Differentiation 19 antibody (PE-Cy7), AW495831 antibody (PE-Cy7), B lymphocytegen CD19 antibody (PE-Cy7), B lymphocyte surfacegen B4 antibody (PE-Cy7), B4 antibody (PE-Cy7), CD19 antibody (PE-Cy7), CD19gen antibody (PE-Cy7), CD19 molecule antibody (PE-Cy7), Cd19 proteinbod antibody (PE-Cy7), deficiency due to defect in CD19 antibody (PE-Cy7), Differentiationgen CD19 antibody (PE-Cy7), included antibody (PE-Cy7), LEU-12 antibody (PE-Cy7), Lymphocyte Surfacegen antibody (PE-Cy7), MGC12802 antibody (PE-Cy7)3870Synthetic peptide (Please contact us for more details)orb43925100 testsCD19 antibody (PerCP)Anti-CD19 antibody5670orb44664100 testsCD19 antibody (PerCP)Anti-CD19 antibody5670orb131268100 ulCD19 antibody (RBITC)Cluster Of Differentiation 19 antibody (RBITC), AW495831 antibody (RBITC), B lymphocytegen CD19 antibody (RBITC), B lymphocyte surfacegen B4 antibody (RBITC), B4 antibody (RBITC), CD19 antibody (RBITC), CD19gen antibody (RBITC), CD19 molecule antibody (RBITC), Cd19 proteinbod antibody (RBITC), deficiency due to defect in CD19 antibody (RBITC), Differentiationgen CD19 antibody (RBITC), included antibody (RBITC), LEU-12 antibody (RBITC), Lymphocyte Surfacegen antibody (RBITC), MGC12802 antibody (RBITC)3870Synthetic peptide (Please contact us for more details)orb263520.2 mgCD19 Pan B-Cells antibodyCD19, Pan B-Cells, Anti-CD19, Pan B-Cells antibody, anti-CD19, Pan B-Cells Primary antibodies, anti-MAb to CD19 Pan B-Cells antibody, CD19, Pan B-Cells Primary antibodies, CD19, Pan B-Cells is a monoclonal antibody to human cds.7182orb198314100 TestsCD19, CD2 antibody (FITC, PE)6120CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.orb19821150 TestsCD19, CD2 antibody (FITC, PE)4590CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.orb198372100 TestsCD19, CD45 antibody (FITC, PE, Cy5)anti CD 45 antibody (FITC/PE/Cy5), anti CD45 antibody (FITC/PE/Cy5), anti CD45 antigen antibody (FITC/PE/Cy5), anti CD45R antibody (FITC/PE/Cy5), anti L CA antibody (FITC/PE/Cy5), anti L-CA antibody (FITC/PE/Cy5), anti LCA antibody (FITC/PE/Cy5), anti Leukocyte common antigen antibody (FITC/PE/Cy5), anti loc antibody (FITC/PE/Cy5), anti Ly-5 antibody (FITC/PE/Cy5), anti LY5 antibody (FITC/PE/Cy5), anti Ly5, homolog of antibody (FITC/PE/Cy5), anti Lyt-4 antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type C antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type c polypeptide antibody (FITC/PE/Cy5), anti protein tyrosine phosphatase, receptor type, C antibody (FITC/PE/Cy5), anti PTPRC antibody (FITC/PE/Cy5), anti Receptor-type tyrosine-protein phosphatase C antibody (FITC/PE/Cy5), anti SCID due to PTPRC deficiency antibody (FITC/PE/Cy5), anti T200 antibody (FITC/PE/Cy5), anti T200 glycoprotein antibody (FITC/PE/Cy5), anti T200 leukocyte common antigen antibody (FITC/PE/Cy5)8280CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD45: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with peripheralorb19824350 TestsCD19, CD45 antibody (FITC, PE, Cy5)anti CD 45 antibody (FITC/PE/Cy5), anti CD45 antibody (FITC/PE/Cy5), anti CD45 antigen antibody (FITC/PE/Cy5), anti CD45R antibody (FITC/PE/Cy5), anti L CA antibody (FITC/PE/Cy5), anti L-CA antibody (FITC/PE/Cy5), anti LCA antibody (FITC/PE/Cy5), anti Leukocyte common antigen antibody (FITC/PE/Cy5), anti loc antibody (FITC/PE/Cy5), anti Ly-5 antibody (FITC/PE/Cy5), anti LY5 antibody (FITC/PE/Cy5), anti Ly5, homolog of antibody (FITC/PE/Cy5), anti Lyt-4 antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type C antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type c polypeptide antibody (FITC/PE/Cy5), anti protein tyrosine phosphatase, receptor type, C antibody (FITC/PE/Cy5), anti PTPRC antibody (FITC/PE/Cy5), anti Receptor-type tyrosine-protein phosphatase C antibody (FITC/PE/Cy5), anti SCID due to PTPRC deficiency antibody (FITC/PE/Cy5), anti T200 antibody (FITC/PE/Cy5), anti T200 glycoprotein antibody (FITC/PE/Cy5), anti T200 leukocyte common antigen antibody (FITC/PE/Cy5)5580CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD45: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with peripheralorb1217120 TestsCD19/CD45 antibody (FITC/PE/Cy5)anti CD 45 antibody (FITC/PE/Cy5), anti CD45 antibody (FITC/PE/Cy5), anti CD45 antigen antibody (FITC/PE/Cy5), anti CD45R antibody (FITC/PE/Cy5), anti L CA antibody (FITC/PE/Cy5), anti L-CA antibody (FITC/PE/Cy5), anti LCA antibody (FITC/PE/Cy5), anti Leukocyte common antigen antibody (FITC/PE/Cy5), anti loc antibody (FITC/PE/Cy5), anti Ly-5 antibody (FITC/PE/Cy5), anti LY5 antibody (FITC/PE/Cy5), anti Ly5, homolog of antibody (FITC/PE/Cy5), anti Lyt-4 antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type C antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type c polypeptide antibody (FITC/PE/Cy5), anti protein tyrosine phosphatase, receptor type, C antibody (FITC/PE/Cy5), anti PTPRC antibody (FITC/PE/Cy5), anti Receptor-type tyrosine-protein phosphatase C antibody (FITC/PE/Cy5), anti SCID due to PTPRC deficiency antibody (FITC/PE/Cy5), anti T200 antibody (FITC/PE/Cy5), anti T200 glycoprotein antibody (FITC/PE/Cy5), anti T200 leukocyte common antigen antibody (FITC/PE/Cy5)2970orb1217150 TestsCD19/CD45 antibody (FITC/PE/Cy5)anti CD 45 antibody (FITC/PE/Cy5), anti CD45 antibody (FITC/PE/Cy5), anti CD45 antigen antibody (FITC/PE/Cy5), anti CD45R antibody (FITC/PE/Cy5), anti L CA antibody (FITC/PE/Cy5), anti L-CA antibody (FITC/PE/Cy5), anti LCA antibody (FITC/PE/Cy5), anti Leukocyte common antigen antibody (FITC/PE/Cy5), anti loc antibody (FITC/PE/Cy5), anti Ly-5 antibody (FITC/PE/Cy5), anti LY5 antibody (FITC/PE/Cy5), anti Ly5, homolog of antibody (FITC/PE/Cy5), anti Lyt-4 antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type C antibody (FITC/PE/Cy5), anti Protein tyrosine phosphatase receptor type c polypeptide antibody (FITC/PE/Cy5), anti protein tyrosine phosphatase, receptor type, C antibody (FITC/PE/Cy5), anti PTPRC antibody (FITC/PE/Cy5), anti Receptor-type tyrosine-protein phosphatase C antibody (FITC/PE/Cy5), anti SCID due to PTPRC deficiency antibody (FITC/PE/Cy5), anti T200 antibody (FITC/PE/Cy5), anti T200 glycoprotein antibody (FITC/PE/Cy5), anti T200 leukocyte common antigen antibody (FITC/PE/Cy5)4770orb229933200 ugCD191 antibody6030orb22993350 ugCD191 antibody3420orb229933100 ugCD191 antibody4680orb311540100 ulCD192 antibody4716KLH Conjugated synthetic peptideorb229936200 ugcd192 antibody6030orb22993650 ugcd192 antibody3420orb229936100 ugcd192 antibody4680orb305468100 ugCD193 antibody3690orb387893100 TestsCD193 antibody (APC)5670orb308752100 TestsCD193 antibody (PE)anti CCR3 antibody5670orb1544090.1 mgCD195 antibody3690CCR5 peptide (Met1-Lys22) KLH conjugateorb3023900.1 mgCD195 antibody9090orb263940.2 mgCD195 antibodyCD195 (CCR5), Anti-CD195 (CCR5) antibody, anti-CD195 (CCR5) Primary antibodies, anti-MAb to CD195 antibody, CD195 (CCR5) Primary antibodies, CD195 (CCR5) is a monoclonal antibody to human cds.10620CHO cells transfected with human CCR5orb154460100 TestsCD195 antibody (APC)5670CCR5 peptide (Met1-Lys22) KLH conjugateorb3023910.1 mgCD195 antibody (FITC)8550orb154530100 TestsCD195 antibody (PE )5670CCR5 peptide (Met1-Lys22) KLH conjugateorb302392100 TestsCD195 antibody (PE)11250orb308640200 TestsCD196 antibodyanti CD196 antibody3780huCCR6 NIH-3T3 transfected cellsorb1798630.1 mgCD197 antibody4410Murine CD197-transfected RBL-2H3 cellsorb2227320.1 mgCD197 antibody (PE)CCR74770Murine CD197-transfected RBL-2H3 cellsorb438140.1 mgCD1a antibodyAnti-CD1a antibody3960orb1817790.5 mlCD1a antibodyanti CD1a antibody5670CBT6 is a mouse monoclonal IgG1 antibody derived by the fusion of NS0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a T-lymphocyte derived antigen.orb273961 mlCD1a antibodyCD1a, human (O10)6750Human thymocytesorb273951 mlCD1a antibodyCD1a, human (MTB1)12672Recombinant protein corresponding to full length extracellular CD1a domainorb3021361 mlCD1a antibody14940orb3022511 mlCD1a antibody14400orb97002100 ugCD1A antibodyanti NME1 antibody4140A synthetic peptide corresponding to a sequence in the middle region of human CD1A.orb301797100 ugCD1a antibody4950orb388814100 ugCD1A antibody4356Human thymus cellsorb388815100 ugCD1A antibody4356Human thymus cellsorb388816100 ugCD1A antibody4356Recombinant human CD1a proteinorb388817100 ugCD1A antibody4356Human thymus cells (O10); Recombinant human CD1a protein (C1A/711)orb388818100 ugCD1A antibody4356Human thymocytesorb388819100 ugCD1A antibody4356Human CD1aorb388820100 ugCD1A antibody4158Recombinant human full-length CD1a proteinorb389770100 ugCD1a antibody3690Human thymocytesorb6186100 ugCD1a antibodyanti-CD1A antibody, anti-CD1 antibody, anti-CD1A Antigen antibody, anti-CD1a molecule antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-Epidermal dendritic cell marker CD1a antibody, anti-FCB 6 antibody, anti-FCB6 antibody, anti-HTA 1 antibody, anti-HTA1 antibody, anti-hTa1 thymocyte antigen antibody, anti-R4 antibody, anti-T Cell Surface Antigen Leu 6 antibody, anti-T Cell Surface Antigen T6 antibody, anti-T cell surface antigen T6/Leu 6 antibody, anti-T Cell Surface Glycoprotein CD1A antibody, anti-T6 antibody, anti-Thymocyte Antigen CD1A antibody CD1D antibody, anti-CD1B antibody, anti-CD1b antigen antibody, anti-CD1b molecule antibody, anti-CD1C antibody, anti-CD1C antigen antibody, anti-CD1c molecule antibody, anti-CD1d molecule antibody, anti-Cd1d1 antibody, anti-Cortical thymocyte antigen CD1C antibody, anti-Cortical thymocyte antigen CD1D antibody, anti-hTa1 thymocyte antigenLy38 antibody, anti-Ly38 antibody, anti-T cell surface glycoprotein CD1a antibody, anti-T cell surface glycoprotein CD1b antibody, anti-T cell surface glycoprotein CD1c antibody, anti-T cell surface glycoprotein CD1d antibody, anti-T6/Leu6 antibody2970KLH conjugated synthetic peptide derived from mouse CD1A. Please contact us for the exact immunogen sequence.orb6186200 ugCD1a antibodyanti-CD1A antibody, anti-CD1 antibody, anti-CD1A Antigen antibody, anti-CD1a molecule antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-Epidermal dendritic cell marker CD1a antibody, anti-FCB 6 antibody, anti-FCB6 antibody, anti-HTA 1 antibody, anti-HTA1 antibody, anti-hTa1 thymocyte antigen antibody, anti-R4 antibody, anti-T Cell Surface Antigen Leu 6 antibody, anti-T Cell Surface Antigen T6 antibody, anti-T cell surface antigen T6/Leu 6 antibody, anti-T Cell Surface Glycoprotein CD1A antibody, anti-T6 antibody, anti-Thymocyte Antigen CD1A antibody CD1D antibody, anti-CD1B antibody, anti-CD1b antigen antibody, anti-CD1b molecule antibody, anti-CD1C antibody, anti-CD1C antigen antibody, anti-CD1c molecule antibody, anti-CD1d molecule antibody, anti-Cd1d1 antibody, anti-Cortical thymocyte antigen CD1C antibody, anti-Cortical thymocyte antigen CD1D antibody, anti-hTa1 thymocyte antigenLy38 antibody, anti-Ly38 antibody, anti-T cell surface glycoprotein CD1a antibody, anti-T cell surface glycoprotein CD1b antibody, anti-T cell surface glycoprotein CD1c antibody, anti-T cell surface glycoprotein CD1d antibody, anti-T6/Leu6 antibody3870KLH conjugated synthetic peptide derived from mouse CD1A. Please contact us for the exact immunogen sequence.orb5788100 ugCD1a antibodyAnti-CD1D antibody, anti-A1 domain antibody, anti-CD1A antibody, anti-CD1A antigen antibody, anti-CD1B antibody, anti-CD1b antigen antibody, anti-CD1b molecule antibody, anti-CD1C antibody, anti-CD1C antigen antibody, anti-CD1c molecule antibody, anti-CD1d molecule antibody, anti-Cd1d1 antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-Cortical thymocyte antigen CD1B antibody, anti-Cortical thymocyte antigen CD1C antibody, anti-Cortical thymocyte antigen CD1D antibody, anti-hTa1 thymocyte antigenLy38 antibody, anti-Ly38 antibody, anti-T cell surface glycoprotein CD1a antibody, anti-T cell surface glycoprotein CD1b antibody, anti-T cell surface glycoprotein CD1c antibody, anti-T cell surface glycoprotein CD1d antibody, anti-T6/Leu6 antibody.2970KLH conjugated synthetic peptide derived from human CD1a. Please contact us for the exact immunogen sequence.orb5788200 ugCD1a antibodyAnti-CD1D antibody, anti-A1 domain antibody, anti-CD1A antibody, anti-CD1A antigen antibody, anti-CD1B antibody, anti-CD1b antigen antibody, anti-CD1b molecule antibody, anti-CD1C antibody, anti-CD1C antigen antibody, anti-CD1c molecule antibody, anti-CD1d molecule antibody, anti-Cd1d1 antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-Cortical thymocyte antigen CD1B antibody, anti-Cortical thymocyte antigen CD1C antibody, anti-Cortical thymocyte antigen CD1D antibody, anti-hTa1 thymocyte antigenLy38 antibody, anti-Ly38 antibody, anti-T cell surface glycoprotein CD1a antibody, anti-T cell surface glycoprotein CD1b antibody, anti-T cell surface glycoprotein CD1c antibody, anti-T cell surface glycoprotein CD1d antibody, anti-T6/Leu6 antibody.3870KLH conjugated synthetic peptide derived from human CD1a. Please contact us for the exact immunogen sequence.orb156301100 ugCD1A antibodyanti-CD 1a antibody, anti-CD1 antibody, anti-CD1a antibody, anti-CD1A antibody, anti-CD1A Antigen antibody, anti-CD1A antigen, a polypeptide antibody, anti-CD1a molecule antibody, anti-CD1A_HUMAN antibody, anti-cluster of dferentiation 1 A antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-dferentiation antigen CD1 alpha 3 antibody, anti-Epidermal dendritic cell marker CD1a antibody, anti-FCB 6 antibody, anti-FCB6 antibody, anti-HTA 1 antibody, anti-HTA1 antibody, anti-hTa1 thymocyte antigen antibody, anti-OTTHUMP00000018907 antibody, anti-R 4 antibody, anti-R4 antibodyT 6 antibody, anti-T Cell Surface Antigen Leu 6 antibody, anti-T Cell Surface Antigen T6 antibody, anti-T cell surface antigen T6/Leu 6 antibody, anti-T Cell Surface Glycoprotein CD1A antibody, anti-T-cell surface antigen T6/Leu-6 antibody, anti-T-cell surface glycoprotein CD1a antibody, anti-T6 antibodyThymocyte Antigen CD1A antibody2970KLH conjugated synthetic peptide derived from mouse CD1Aorb156301200 ugCD1A antibodyanti-CD 1a antibody, anti-CD1 antibody, anti-CD1a antibody, anti-CD1A antibody, anti-CD1A Antigen antibody, anti-CD1A antigen, a polypeptide antibody, anti-CD1a molecule antibody, anti-CD1A_HUMAN antibody, anti-cluster of dferentiation 1 A antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-dferentiation antigen CD1 alpha 3 antibody, anti-Epidermal dendritic cell marker CD1a antibody, anti-FCB 6 antibody, anti-FCB6 antibody, anti-HTA 1 antibody, anti-HTA1 antibody, anti-hTa1 thymocyte antigen antibody, anti-OTTHUMP00000018907 antibody, anti-R 4 antibody, anti-R4 antibodyT 6 antibody, anti-T Cell Surface Antigen Leu 6 antibody, anti-T Cell Surface Antigen T6 antibody, anti-T cell surface antigen T6/Leu 6 antibody, anti-T Cell Surface Glycoprotein CD1A antibody, anti-T-cell surface antigen T6/Leu-6 antibody, anti-T-cell surface glycoprotein CD1a antibody, anti-T6 antibodyThymocyte Antigen CD1A antibody3870KLH conjugated synthetic peptide derived from mouse CD1Aorb69399100 ulCD1A antibodyanti R4 antibody, anti T6 antibody, anti CD1 antibody, anti FCB6 antibody, anti HTA1 antibody, anti CD1A antibody3960Purified recombinant fragment of human CD1A expressed in E. Coli.orb69401100 ulCD1A antibodyanti R4 antibody, anti T6 antibody, anti CD1 antibody, anti FCB6 antibody, anti HTA1 antibody, anti CD1A antibody3960Purified recombinant fragment of human CD1A expressed in E. Coli.orb175882100 ulCD1a antibody5580Prokaryotic recombinant fusion protein corresponding to the full external domain of the human CD1a moleculeorb192906100 ulCD1A antibodyanti R4 antibody, anti T6 antibody, anti CD1 antibody, anti FCB6 antibody, anti HTA1 antibody4716Recombinant protein of human CD1A.orb387311100 ulCD1A antibody6948N-terminal region of human CD1Aorb394240100 ulCD1A antibody3798Recombinant fragment of human CD1A expressed in E. Coliorb39424050 ulCD1A antibody3258Recombinant fragment of human CD1A expressed in E. Coliorb43817100 testsCD1a antibodyAnti-CD1a antibody5670orb5598420 ugCD1a antibody3960Human thymus cells were used as the immunogen for this CD1a antibody.orb55984100 ugCD1a antibody5850Human thymus cells were used as the immunogen for this CD1a antibody.orb5598520 ugCD1a antibody3960Recombinant human CD1a protein was used as the immunogen for this antibody.orb55985100 ugCD1a antibody5850Recombinant human CD1a protein was used as the immunogen for this antibody.orb5620420 ugCD1a antibody3960Human thymocytes were used as the immunogen for the CD1a antibody.orb56204100 ugCD1a antibody5850Human thymocytes were used as the immunogen for the CD1a antibody.orb5620520 ugCD1a antibody3960Human recombinant protein was used as the immunogen for the CD1a antibody.orb56205100 ugCD1a antibody5850Human recombinant protein was used as the immunogen for the CD1a antibody.orb5630620 ugCD1a antibody3960Human CD1a protein was used as the immunogen for this CD1a antibody.orb56306100 ugCD1a antibody5850Human CD1a protein was used as the immunogen for this CD1a antibody.orb5640620 ugCD1a antibody3960Recombinant human protein was used as the immunogen for this CD1a antibody.orb56406100 ugCD1a antibody5850Recombinant human protein was used as the immunogen for this CD1a antibody.orb5646720 ugCD1a antibody4500Full length human CD1a protein was used as the immunogen for this recombinant CD1a antibody.orb56467100 ugCD1a antibody6570Full length human CD1a protein was used as the immunogen for this recombinant CD1a antibody.orb340958200 ulCD1A antibody6210Recombinant full length protein of human CD1aorb340958100 ulCD1A antibody4050Recombinant full length protein of human CD1aorb31621400 ulCD1A antibodyAnti-T-cell surface glycoprotein CD1a antibody, anti-CD1A antibody4050This CD1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 75-104 amino acids from the Central region of human CD1A.orb35291250 ulCD1A antibodyanti-T-cell surface antigen T6/Leu-6 antibody, anti-hTa1 thymocyte antigen antibody, anti-CD1A antibody2520Recombinant human T-cell surface glycoprotein CD1a protein (21-181aa)orb352912100 ulCD1A antibodyanti-T-cell surface antigen T6/Leu-6 antibody, anti-hTa1 thymocyte antigen antibody, anti-CD1A antibody3420Recombinant human T-cell surface glycoprotein CD1a protein (21-181aa)orb35327750 ulCD1A antibodyanti-T-cell surface antigen T6/Leu-6 antibody, anti-hTa1 thymocyte antigen antibody, anti-CD1A antibody2520Recombinant human T-cell surface glycoprotein CD1a protein (21-181aa)orb353277100 ulCD1A antibodyanti-T-cell surface antigen T6/Leu-6 antibody, anti-hTa1 thymocyte antigen antibody, anti-CD1A antibody3420Recombinant human T-cell surface glycoprotein CD1a protein (21-181aa)orb17852750 ulCD1A antibodyanti R4 antibody, anti T6 antibody, anti CD1 antibody, anti FCB6 antibody, anti HTA1 antibody3060Recombinant protein of human CD1Aorb178527100 ulCD1A antibodyanti R4 antibody, anti T6 antibody, anti CD1 antibody, anti FCB6 antibody, anti HTA1 antibody4140Recombinant protein of human CD1Aorb178527200 ulCD1A antibodyanti R4 antibody, anti T6 antibody, anti CD1 antibody, anti FCB6 antibody, anti HTA1 antibody6480Recombinant protein of human CD1Aorb22635500 ugCD1A antibodyT-cell surface antigen T6/Leu-6, hTa1 thymocyte antigen, R4, T6; CD1, FCB6, HTA13996Purified human PBL cells.orb226351 mgCD1A antibodyT-cell surface antigen T6/Leu-6, hTa1 thymocyte antigen, R4, T6; CD1, FCB6, HTA16840Purified human PBL cells.orb178440500 ulCD1a antibody7650peptide derived from C-terminal region, near the transmembrane domain of human CD1-aorb1784401 mlCD1a antibody12150peptide derived from C-terminal region, near the transmembrane domain of human CD1-aorb178440100 ulCD1a antibody5526peptide derived from C-terminal region, near the transmembrane domain of human CD1-aorb178440200 ulCD1a antibody5958peptide derived from C-terminal region, near the transmembrane domain of human CD1-aorb111551100 ulCD1A antibody (Alexa 488)CD1A antibody (Alexa 488), CD1 antibody (Alexa 488), CD1A Antigen antibody (Alexa 488), CD1a molecule antibody (Alexa 488), Cortical thymocyte antigen CD1A antibody (Alexa 488), Epidermal dendritic cell marker CD1a antibody (Alexa 488), FCB 6 antibody (Alexa 488), FCB6 antibody (Alexa 488), HTA 1 antibody (Alexa 488), HTA1 antibody (Alexa 488), hTa1 thymocyte antigen antibody (Alexa 488), R4 antibody (Alexa 488), T Cell Surface Antigen Leu 6 antibody (Alexa 488), T Cell Surface Antigen T6 antibody (Alexa 488), T cell surface antigen T6/Leu 6 antibody (Alexa 488), T Cell Surface Glycoprotein CD1A antibody (Alexa 488), T6 antibody (Alexa 488), Thymocyte Antigen CD1A antibody (Alexa 488) CD1D antibody (Alexa 488), CD1B antibody (Alexa 488), CD1b antigen antibody (Alexa 488), CD1b molecule antibody (Alexa 488), CD1C antibody (Alexa 488), CD1C antigen antibody (Alexa 488), CD1c molecule antibody (Alexa 488), CD1d molecule antibody (Alexa 488), Cd1d1 antibody (Alexa 488), Cortical thymocyte antigen CD1C antibody (Alexa 488), Cortical thymocyte antigen CD1D antibody (Alexa 488), hTa1 thymocyte antigenLy38 antibody (Alexa 488), Ly38 antibody (Alexa 488), T cell surface glycoprotein CD1a antibody (Alexa 488), T cell surface glycoprotein CD1b antibody (Alexa 488), T cell surface glycoprotein CD1c antibody (Alexa 488), T cell surface glycoprotein CD1d antibody (Alexa 488), T6/Leu6 antibody (Alexa 488)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb111059100 ulCD1A antibody (Alexa Fluor 350)CD1A antibody (Alexa Fluor 350), CD1 antibody (Alexa Fluor 350), CD1A Antigen antibody (Alexa Fluor 350), CD1a molecule antibody (Alexa Fluor 350), Cortical thymocyte antigen CD1A antibody (Alexa Fluor 350), Epidermal dendritic cell marker CD1a antibody (Alexa Fluor 350), FCB 6 antibody (Alexa Fluor 350), FCB6 antibody (Alexa Fluor 350), HTA 1 antibody (Alexa Fluor 350), HTA1 antibody (Alexa Fluor 350), hTa1 thymocyte antigen antibody (Alexa Fluor 350), R4 antibody (Alexa Fluor 350), T Cell Surface Antigen Leu 6 antibody (Alexa Fluor 350), T Cell Surface Antigen T6 antibody (Alexa Fluor 350), T cell surface antigen T6/Leu 6 antibody (Alexa Fluor 350), T Cell Surface Glycoprotein CD1A antibody (Alexa Fluor 350), T6 antibody (Alexa Fluor 350), Thymocyte Antigen CD1A antibody (Alexa Fluor 350) CD1D antibody (Alexa Fluor 350), CD1B antibody (Alexa Fluor 350), CD1b antigen antibody (Alexa Fluor 350), CD1b molecule antibody (Alexa Fluor 350), CD1C antibody (Alexa Fluor 350), CD1C antigen antibody (Alexa Fluor 350), CD1c molecule antibody (Alexa Fluor 350), CD1d molecule antibody (Alexa Fluor 350), Cd1d1 antibody (Alexa Fluor 350), Cortical thymocyte antigen CD1C antibody (Alexa Fluor 350), Cortical thymocyte antigen CD1D antibody (Alexa Fluor 350), hTa1 thymocyte antigenLy38 antibody (Alexa Fluor 350), Ly38 antibody (Alexa Fluor 350), T cell surface glycoprotein CD1a antibody (Alexa Fluor 350), T cell surface glycoprotein CD1b antibody (Alexa Fluor 350), T cell surface glycoprotein CD1c antibody (Alexa Fluor 350), T cell surface glycoprotein CD1d antibody (Alexa Fluor 350), T6/Leu6 antibody (Alexa Fluor 350)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb113520100 ulCD1A antibody (Alkaline Phosphatase)CD1A antibody (Alkaline Phosphatase), CD1 antibody (Alkaline Phosphatase), CD1A Antigen antibody (Alkaline Phosphatase), CD1a molecule antibody (Alkaline Phosphatase), Cortical thymocyte antigen CD1A antibody (Alkaline Phosphatase), Epidermal dendritic cell marker CD1a antibody (Alkaline Phosphatase), FCB 6 antibody (Alkaline Phosphatase), FCB6 antibody (Alkaline Phosphatase), HTA 1 antibody (Alkaline Phosphatase), HTA1 antibody (Alkaline Phosphatase), hTa1 thymocyte antigen antibody (Alkaline Phosphatase), R4 antibody (Alkaline Phosphatase), T Cell Surface Antigen Leu 6 antibody (Alkaline Phosphatase), T Cell Surface Antigen T6 antibody (Alkaline Phosphatase), T cell surface antigen T6/Leu 6 antibody (Alkaline Phosphatase), T Cell Surface Glycoprotein CD1A antibody (Alkaline Phosphatase), T6 antibody (Alkaline Phosphatase), Thymocyte Antigen CD1A antibody (Alkaline Phosphatase) CD1D antibody (Alkaline Phosphatase), CD1B antibody (Alkaline Phosphatase), CD1b antigen antibody (Alkaline Phosphatase), CD1b molecule antibody (Alkaline Phosphatase), CD1C antibody (Alkaline Phosphatase), CD1C antigen antibody (Alkaline Phosphatase), CD1c molecule antibody (Alkaline Phosphatase), CD1d molecule antibody (Alkaline Phosphatase), Cd1d1 antibody (Alkaline Phosphatase), Cortical thymocyte antigen CD1C antibody (Alkaline Phosphatase), Cortical thymocyte antigen CD1D antibody (Alkaline Phosphatase), hTa1 thymocyte antigenLy38 antibody (Alkaline Phosphatase), Ly38 antibody (Alkaline Phosphatase), T cell surface glycoprotein CD1a antibody (Alkaline Phosphatase), T cell surface glycoprotein CD1b antibody (Alkaline Phosphatase), T cell surface glycoprotein CD1c antibody (Alkaline Phosphatase), T cell surface glycoprotein CD1d antibody (Alkaline Phosphatase), T6/Leu6 antibody (Alkaline Phosphatase)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb389773100 testsCD1a antibody (APC)5670Human thymocytesorb114013100 ulCD1A antibody (Biotin)CD1A antibody (Biotin), CD1 antibody (Biotin), CD1A Antigen antibody (Biotin), CD1a molecule antibody (Biotin), Cortical thymocyte antigen CD1A antibody (Biotin), Epidermal dendritic cell marker CD1a antibody (Biotin), FCB 6 antibody (Biotin), FCB6 antibody (Biotin), HTA 1 antibody (Biotin), HTA1 antibody (Biotin), hTa1 thymocyte antigen antibody (Biotin), R4 antibody (Biotin), T Cell Surface Antigen Leu 6 antibody (Biotin), T Cell Surface Antigen T6 antibody (Biotin), T cell surface antigen T6/Leu 6 antibody (Biotin), T Cell Surface Glycoprotein CD1A antibody (Biotin), T6 antibody (Biotin), Thymocyte Antigen CD1A antibody (Biotin) CD1D antibody (Biotin), CD1B antibody (Biotin), CD1b antigen antibody (Biotin), CD1b molecule antibody (Biotin), CD1C antibody (Biotin), CD1C antigen antibody (Biotin), CD1c molecule antibody (Biotin), CD1d molecule antibody (Biotin), Cd1d1 antibody (Biotin), Cortical thymocyte antigen CD1C antibody (Biotin), Cortical thymocyte antigen CD1D antibody (Biotin), hTa1 thymocyte antigenLy38 antibody (Biotin), Ly38 antibody (Biotin), T cell surface glycoprotein CD1a antibody (Biotin), T cell surface glycoprotein CD1b antibody (Biotin), T cell surface glycoprotein CD1c antibody (Biotin), T cell surface glycoprotein CD1d antibody (Biotin), T6/Leu6 antibody (Biotin)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb114505100 ulCD1A antibody (Cy3)CD1A antibody (Cy3), CD1 antibody (Cy3), CD1A Antigen antibody (Cy3), CD1a molecule antibody (Cy3), Cortical thymocyte antigen CD1A antibody (Cy3), Epidermal dendritic cell marker CD1a antibody (Cy3), FCB 6 antibody (Cy3), FCB6 antibody (Cy3), HTA 1 antibody (Cy3), HTA1 antibody (Cy3), hTa1 thymocyte antigen antibody (Cy3), R4 antibody (Cy3), T Cell Surface Antigen Leu 6 antibody (Cy3), T Cell Surface Antigen T6 antibody (Cy3), T cell surface antigen T6/Leu 6 antibody (Cy3), T Cell Surface Glycoprotein CD1A antibody (Cy3), T6 antibody (Cy3), Thymocyte Antigen CD1A antibody (Cy3) CD1D antibody (Cy3), CD1B antibody (Cy3), CD1b antigen antibody (Cy3), CD1b molecule antibody (Cy3), CD1C antibody (Cy3), CD1C antigen antibody (Cy3), CD1c molecule antibody (Cy3), CD1d molecule antibody (Cy3), Cd1d1 antibody (Cy3), Cortical thymocyte antigen CD1C antibody (Cy3), Cortical thymocyte antigen CD1D antibody (Cy3), hTa1 thymocyte antigenLy38 antibody (Cy3), Ly38 antibody (Cy3), T cell surface glycoprotein CD1a antibody (Cy3), T cell surface glycoprotein CD1b antibody (Cy3), T cell surface glycoprotein CD1c antibody (Cy3), T cell surface glycoprotein CD1d antibody (Cy3), T6/Leu6 antibody (Cy3)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb114997100 ulCD1A antibody (Cy5)CD1A antibody (Cy5), CD1 antibody (Cy5), CD1A Antigen antibody (Cy5), CD1a molecule antibody (Cy5), Cortical thymocyte antigen CD1A antibody (Cy5), Epidermal dendritic cell marker CD1a antibody (Cy5), FCB 6 antibody (Cy5), FCB6 antibody (Cy5), HTA 1 antibody (Cy5), HTA1 antibody (Cy5), hTa1 thymocyte antigen antibody (Cy5), R4 antibody (Cy5), T Cell Surface Antigen Leu 6 antibody (Cy5), T Cell Surface Antigen T6 antibody (Cy5), T cell surface antigen T6/Leu 6 antibody (Cy5), T Cell Surface Glycoprotein CD1A antibody (Cy5), T6 antibody (Cy5), Thymocyte Antigen CD1A antibody (Cy5) CD1D antibody (Cy5), CD1B antibody (Cy5), CD1b antigen antibody (Cy5), CD1b molecule antibody (Cy5), CD1C antibody (Cy5), CD1C antigen antibody (Cy5), CD1c molecule antibody (Cy5), CD1d molecule antibody (Cy5), Cd1d1 antibody (Cy5), Cortical thymocyte antigen CD1C antibody (Cy5), Cortical thymocyte antigen CD1D antibody (Cy5), hTa1 thymocyte antigenLy38 antibody (Cy5), Ly38 antibody (Cy5), T cell surface glycoprotein CD1a antibody (Cy5), T cell surface glycoprotein CD1b antibody (Cy5), T cell surface glycoprotein CD1c antibody (Cy5), T cell surface glycoprotein CD1d antibody (Cy5), T6/Leu6 antibody (Cy5)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb123038100 ulCD1A antibody (Cy5.5)CD1A antibody (Cy5.5), CD1 antibody (Cy5.5), CD1A Antigen antibody (Cy5.5), CD1a molecule antibody (Cy5.5), Cortical thymocyte antigen CD1A antibody (Cy5.5), Epidermal dendritic cell marker CD1a antibody (Cy5.5), FCB 6 antibody (Cy5.5), FCB6 antibody (Cy5.5), HTA 1 antibody (Cy5.5), HTA1 antibody (Cy5.5), hTa1 thymocyte antigen antibody (Cy5.5), R4 antibody (Cy5.5), T Cell Surface Antigen Leu 6 antibody (Cy5.5), T Cell Surface Antigen T6 antibody (Cy5.5), T cell surface antigen T6/Leu 6 antibody (Cy5.5), T Cell Surface Glycoprotein CD1A antibody (Cy5.5), T6 antibody (Cy5.5), Thymocyte Antigen CD1A antibody (Cy5.5) CD1D antibody (Cy5.5), CD1B antibody (Cy5.5), CD1b antigen antibody (Cy5.5), CD1b molecule antibody (Cy5.5), CD1C antibody (Cy5.5), CD1C antigen antibody (Cy5.5), CD1c molecule antibody (Cy5.5), CD1d molecule antibody (Cy5.5), Cd1d1 antibody (Cy5.5), Cortical thymocyte antigen CD1C antibody (Cy5.5), Cortical thymocyte antigen CD1D antibody (Cy5.5), hTa1 thymocyte antigenLy38 antibody (Cy5.5), Ly38 antibody (Cy5.5), T cell surface glycoprotein CD1a antibody (Cy5.5), T cell surface glycoprotein CD1b antibody (Cy5.5), T cell surface glycoprotein CD1c antibody (Cy5.5), T cell surface glycoprotein CD1d antibody (Cy5.5), T6/Leu6 antibody (Cy5.5)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb123530100 ulCD1A antibody (Cy7)CD1A antibody (Cy7), CD1 antibody (Cy7), CD1A Antigen antibody (Cy7), CD1a molecule antibody (Cy7), Cortical thymocyte antigen CD1A antibody (Cy7), Epidermal dendritic cell marker CD1a antibody (Cy7), FCB 6 antibody (Cy7), FCB6 antibody (Cy7), HTA 1 antibody (Cy7), HTA1 antibody (Cy7), hTa1 thymocyte antigen antibody (Cy7), R4 antibody (Cy7), T Cell Surface Antigen Leu 6 antibody (Cy7), T Cell Surface Antigen T6 antibody (Cy7), T cell surface antigen T6/Leu 6 antibody (Cy7), T Cell Surface Glycoprotein CD1A antibody (Cy7), T6 antibody (Cy7), Thymocyte Antigen CD1A antibody (Cy7) CD1D antibody (Cy7), CD1B antibody (Cy7), CD1b antigen antibody (Cy7), CD1b molecule antibody (Cy7), CD1C antibody (Cy7), CD1C antigen antibody (Cy7), CD1c molecule antibody (Cy7), CD1d molecule antibody (Cy7), Cd1d1 antibody (Cy7), Cortical thymocyte antigen CD1C antibody (Cy7), Cortical thymocyte antigen CD1D antibody (Cy7), hTa1 thymocyte antigenLy38 antibody (Cy7), Ly38 antibody (Cy7), T cell surface glycoprotein CD1a antibody (Cy7), T cell surface glycoprotein CD1b antibody (Cy7), T cell surface glycoprotein CD1c antibody (Cy7), T cell surface glycoprotein CD1d antibody (Cy7), T6/Leu6 antibody (Cy7)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb9034100 ugCD1a antibody (FITC)anti-CD1a antibody, anti-CD1a antibody, anti-CD1a antibody, anti-CD1a antibody3870KLH conjugated synthetic peptide derived from human CD1a/Cortical thymocyte antigen CD1A. Please contact us for the exact immunogen sequence.orb8636100 ugCD1a antibody (FITC)Anti-CD1D antibody, anti-A1 domain antibody, anti-CD1A antibody, anti-CD1A antigen antibody, anti-CD1B antibody, anti-CD1b antigen antibody, anti-CD1b molecule antibody, anti-CD1C antibody, anti-CD1C antigen antibody, anti-CD1c molecule antibody, anti-CD1d molecule antibody, anti-Cd1d1 antibody, anti-Cortical thymocyte antigen CD1A antibody, anti-Cortical thymocyte antigen CD1B antibody, anti-Cortical thymocyte antigen CD1C antibody, anti-Cortical thymocyte antigen CD1D antibody, anti-hTa1 thymocyte antigenLy38 antibody, anti-Ly38 antibody, anti-T cell surface glycoprotein CD1a antibody, anti-T cell surface glycoprotein CD1b antibody, anti-T cell surface glycoprotein CD1c antibody, anti-T cell surface glycoprotein CD1d antibody, anti-T6/Leu6 antibody.3870KLH conjugated synthetic peptide derived from human CD1a/Cortical thymocyte antigen CD1A. Please contact us for the exact immunogen sequence.orb43815100 testsCD1a antibody (FITC)Anti-CD1a antibody4770orb385486100 TestsCD1a antibody (FITC)4320orb389771100 testsCD1a antibody (FITC)4770Human thymocytesorb110073100 ulCD1A antibody (HRP)CD1A antibody (HRP), CD1 antibody (HRP), CD1A Antigen antibody (HRP), CD1a molecule antibody (HRP), Cortical thymocyte antigen CD1A antibody (HRP), Epidermal dendritic cell marker CD1a antibody (HRP), FCB 6 antibody (HRP), FCB6 antibody (HRP), HTA 1 antibody (HRP), HTA1 antibody (HRP), hTa1 thymocyte antigen antibody (HRP), R4 antibody (HRP), T Cell Surface Antigen Leu 6 antibody (HRP), T Cell Surface Antigen T6 antibody (HRP), T cell surface antigen T6/Leu 6 antibody (HRP), T Cell Surface Glycoprotein CD1A antibody (HRP), T6 antibody (HRP), Thymocyte Antigen CD1A antibody (HRP) CD1D antibody (HRP), CD1B antibody (HRP), CD1b antigen antibody (HRP), CD1b molecule antibody (HRP), CD1C antibody (HRP), CD1C antigen antibody (HRP), CD1c molecule antibody (HRP), CD1d molecule antibody (HRP), Cd1d1 antibody (HRP), Cortical thymocyte antigen CD1C antibody (HRP), Cortical thymocyte antigen CD1D antibody (HRP), hTa1 thymocyte antigenLy38 antibody (HRP), Ly38 antibody (HRP), T cell surface glycoprotein CD1a antibody (HRP), T cell surface glycoprotein CD1b antibody (HRP), T cell surface glycoprotein CD1c antibody (HRP), T cell surface glycoprotein CD1d antibody (HRP), T6/Leu6 antibody (HRP)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb124514100 ulCD1A antibody (PE)CD1A antibody (PE), CD1 antibody (PE), CD1A Antigen antibody (PE), CD1a molecule antibody (PE), Cortical thymocyte antigen CD1A antibody (PE), Epidermal dendritic cell marker CD1a antibody (PE), FCB 6 antibody (PE), FCB6 antibody (PE), HTA 1 antibody (PE), HTA1 antibody (PE), hTa1 thymocyte antigen antibody (PE), R4 antibody (PE), T Cell Surface Antigen Leu 6 antibody (PE), T Cell Surface Antigen T6 antibody (PE), T cell surface antigen T6/Leu 6 antibody (PE), T Cell Surface Glycoprotein CD1A antibody (PE), T6 antibody (PE), Thymocyte Antigen CD1A antibody (PE) CD1D antibody (PE), CD1B antibody (PE), CD1b antigen antibody (PE), CD1b molecule antibody (PE), CD1C antibody (PE), CD1C antigen antibody (PE), CD1c molecule antibody (PE), CD1d molecule antibody (PE), Cd1d1 antibody (PE), Cortical thymocyte antigen CD1C antibody (PE), Cortical thymocyte antigen CD1D antibody (PE), hTa1 thymocyte antigenLy38 antibody (PE), Ly38 antibody (PE), T cell surface glycoprotein CD1a antibody (PE), T cell surface glycoprotein CD1b antibody (PE), T cell surface glycoprotein CD1c antibody (PE), T cell surface glycoprotein CD1d antibody (PE), T6/Leu6 antibody (PE)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb43816100 testsCD1a antibody (PE)Anti-CD1a antibody5670orb389772100 testsCD1a antibody (PE)5670Human thymocytesorb125291100 ulCD1A antibody (PE-Cy3)CD1A antibody (PE-Cy3), CD1 antibody (PE-Cy3), CD1A Antigen antibody (PE-Cy3), CD1a molecule antibody (PE-Cy3), Cortical thymocyte antigen CD1A antibody (PE-Cy3), Epidermal dendritic cell marker CD1a antibody (PE-Cy3), FCB 6 antibody (PE-Cy3), FCB6 antibody (PE-Cy3), HTA 1 antibody (PE-Cy3), HTA1 antibody (PE-Cy3), hTa1 thymocyte antigen antibody (PE-Cy3), R4 antibody (PE-Cy3), T Cell Surface Antigen Leu 6 antibody (PE-Cy3), T Cell Surface Antigen T6 antibody (PE-Cy3), T cell surface antigen T6/Leu 6 antibody (PE-Cy3), T Cell Surface Glycoprotein CD1A antibody (PE-Cy3), T6 antibody (PE-Cy3), Thymocyte Antigen CD1A antibody (PE-Cy3) CD1D antibody (PE-Cy3), CD1B antibody (PE-Cy3), CD1b antigen antibody (PE-Cy3), CD1b molecule antibody (PE-Cy3), CD1C antibody (PE-Cy3), CD1C antigen antibody (PE-Cy3), CD1c molecule antibody (PE-Cy3), CD1d molecule antibody (PE-Cy3), Cd1d1 antibody (PE-Cy3), Cortical thymocyte antigen CD1C antibody (PE-Cy3), Cortical thymocyte antigen CD1D antibody (PE-Cy3), hTa1 thymocyte antigenLy38 antibody (PE-Cy3), Ly38 antibody (PE-Cy3), T cell surface glycoprotein CD1a antibody (PE-Cy3), T cell surface glycoprotein CD1b antibody (PE-Cy3), T cell surface glycoprotein CD1c antibody (PE-Cy3), T cell surface glycoprotein CD1d antibody (PE-Cy3), T6/Leu6 antibody (PE-Cy3)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb129793100 ulCD1A antibody (PE-Cy5)CD1A antibody (PE-Cy5), CD1 antibody (PE-Cy5), CD1A Antigen antibody (PE-Cy5), CD1a molecule antibody (PE-Cy5), Cortical thymocyte antigen CD1A antibody (PE-Cy5), Epidermal dendritic cell marker CD1a antibody (PE-Cy5), FCB 6 antibody (PE-Cy5), FCB6 antibody (PE-Cy5), HTA 1 antibody (PE-Cy5), HTA1 antibody (PE-Cy5), hTa1 thymocyte antigen antibody (PE-Cy5), R4 antibody (PE-Cy5), T Cell Surface Antigen Leu 6 antibody (PE-Cy5), T Cell Surface Antigen T6 antibody (PE-Cy5), T cell surface antigen T6/Leu 6 antibody (PE-Cy5), T Cell Surface Glycoprotein CD1A antibody (PE-Cy5), T6 antibody (PE-Cy5), Thymocyte Antigen CD1A antibody (PE-Cy5) CD1D antibody (PE-Cy5), CD1B antibody (PE-Cy5), CD1b antigen antibody (PE-Cy5), CD1b molecule antibody (PE-Cy5), CD1C antibody (PE-Cy5), CD1C antigen antibody (PE-Cy5), CD1c molecule antibody (PE-Cy5), CD1d molecule antibody (PE-Cy5), Cd1d1 antibody (PE-Cy5), Cortical thymocyte antigen CD1C antibody (PE-Cy5), Cortical thymocyte antigen CD1D antibody (PE-Cy5), hTa1 thymocyte antigenLy38 antibody (PE-Cy5), Ly38 antibody (PE-Cy5), T cell surface glycoprotein CD1a antibody (PE-Cy5), T cell surface glycoprotein CD1b antibody (PE-Cy5), T cell surface glycoprotein CD1c antibody (PE-Cy5), T cell surface glycoprotein CD1d antibody (PE-Cy5), T6/Leu6 antibody (PE-Cy5)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb130285100 ulCD1A antibody (PE-Cy5.5)CD1A antibody (PE-Cy5.5), CD1 antibody (PE-Cy5.5), CD1A Antigen antibody (PE-Cy5.5), CD1a molecule antibody (PE-Cy5.5), Cortical thymocyte antigen CD1A antibody (PE-Cy5.5), Epidermal dendritic cell marker CD1a antibody (PE-Cy5.5), FCB 6 antibody (PE-Cy5.5), FCB6 antibody (PE-Cy5.5), HTA 1 antibody (PE-Cy5.5), HTA1 antibody (PE-Cy5.5), hTa1 thymocyte antigen antibody (PE-Cy5.5), R4 antibody (PE-Cy5.5), T Cell Surface Antigen Leu 6 antibody (PE-Cy5.5), T Cell Surface Antigen T6 antibody (PE-Cy5.5), T cell surface antigen T6/Leu 6 antibody (PE-Cy5.5), T Cell Surface Glycoprotein CD1A antibody (PE-Cy5.5), T6 antibody (PE-Cy5.5), Thymocyte Antigen CD1A antibody (PE-Cy5.5) CD1D antibody (PE-Cy5.5), CD1B antibody (PE-Cy5.5), CD1b antigen antibody (PE-Cy5.5), CD1b molecule antibody (PE-Cy5.5), CD1C antibody (PE-Cy5.5), CD1C antigen antibody (PE-Cy5.5), CD1c molecule antibody (PE-Cy5.5), CD1d molecule antibody (PE-Cy5.5), Cd1d1 antibody (PE-Cy5.5), Cortical thymocyte antigen CD1C antibody (PE-Cy5.5), Cortical thymocyte antigen CD1D antibody (PE-Cy5.5), hTa1 thymocyte antigenLy38 antibody (PE-Cy5.5), Ly38 antibody (PE-Cy5.5), T cell surface glycoprotein CD1a antibody (PE-Cy5.5), T cell surface glycoprotein CD1b antibody (PE-Cy5.5), T cell surface glycoprotein CD1c antibody (PE-Cy5.5), T cell surface glycoprotein CD1d antibody (PE-Cy5.5), T6/Leu6 antibody (PE-Cy5.5)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb130777100 ulCD1A antibody (PE-Cy7)CD1A antibody (PE-Cy7), CD1 antibody (PE-Cy7), CD1A Antigen antibody (PE-Cy7), CD1a molecule antibody (PE-Cy7), Cortical thymocyte antigen CD1A antibody (PE-Cy7), Epidermal dendritic cell marker CD1a antibody (PE-Cy7), FCB 6 antibody (PE-Cy7), FCB6 antibody (PE-Cy7), HTA 1 antibody (PE-Cy7), HTA1 antibody (PE-Cy7), hTa1 thymocyte antigen antibody (PE-Cy7), R4 antibody (PE-Cy7), T Cell Surface Antigen Leu 6 antibody (PE-Cy7), T Cell Surface Antigen T6 antibody (PE-Cy7), T cell surface antigen T6/Leu 6 antibody (PE-Cy7), T Cell Surface Glycoprotein CD1A antibody (PE-Cy7), T6 antibody (PE-Cy7), Thymocyte Antigen CD1A antibody (PE-Cy7) CD1D antibody (PE-Cy7), CD1B antibody (PE-Cy7), CD1b antigen antibody (PE-Cy7), CD1b molecule antibody (PE-Cy7), CD1C antibody (PE-Cy7), CD1C antigen antibody (PE-Cy7), CD1c molecule antibody (PE-Cy7), CD1d molecule antibody (PE-Cy7), Cd1d1 antibody (PE-Cy7), Cortical thymocyte antigen CD1C antibody (PE-Cy7), Cortical thymocyte antigen CD1D antibody (PE-Cy7), hTa1 thymocyte antigenLy38 antibody (PE-Cy7), Ly38 antibody (PE-Cy7), T cell surface glycoprotein CD1a antibody (PE-Cy7), T cell surface glycoprotein CD1b antibody (PE-Cy7), T cell surface glycoprotein CD1c antibody (PE-Cy7), T cell surface glycoprotein CD1d antibody (PE-Cy7), T6/Leu6 antibody (PE-Cy7)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb131269100 ulCD1A antibody (RBITC)CD1A antibody (RBITC), CD1 antibody (RBITC), CD1A Antigen antibody (RBITC), CD1a molecule antibody (RBITC), Cortical thymocyte antigen CD1A antibody (RBITC), Epidermal dendritic cell marker CD1a antibody (RBITC), FCB 6 antibody (RBITC), FCB6 antibody (RBITC), HTA 1 antibody (RBITC), HTA1 antibody (RBITC), hTa1 thymocyte antigen antibody (RBITC), R4 antibody (RBITC), T Cell Surface Antigen Leu 6 antibody (RBITC), T Cell Surface Antigen T6 antibody (RBITC), T cell surface antigen T6/Leu 6 antibody (RBITC), T Cell Surface Glycoprotein CD1A antibody (RBITC), T6 antibody (RBITC), Thymocyte Antigen CD1A antibody (RBITC) CD1D antibody (RBITC), CD1B antibody (RBITC), CD1b antigen antibody (RBITC), CD1b molecule antibody (RBITC), CD1C antibody (RBITC), CD1C antigen antibody (RBITC), CD1c molecule antibody (RBITC), CD1d molecule antibody (RBITC), Cd1d1 antibody (RBITC), Cortical thymocyte antigen CD1C antibody (RBITC), Cortical thymocyte antigen CD1D antibody (RBITC), hTa1 thymocyte antigenLy38 antibody (RBITC), Ly38 antibody (RBITC), T cell surface glycoprotein CD1a antibody (RBITC), T cell surface glycoprotein CD1b antibody (RBITC), T cell surface glycoprotein CD1c antibody (RBITC), T cell surface glycoprotein CD1d antibody (RBITC), T6/Leu6 antibody (RBITC)3870KLH conjugated synthetic peptide derived from mouse CD1A.orb24821520 ugCD1a Cocktail antibodyanti Cortical thymocyte antigen CD1A antibody, anti Epidermal dendritic cell marker CD1a antibody antibody, anti FCB6 antibody, anti HTA1 antibody, anti T cell surface antigen T6 / Leu 6 antibody, anti T-Cell Surface Glycoprotein CD1A antibody, anti CD1a antibody antibody3960Human thymus cells (O10) andrecombinant human CD1a protein (C1A/711) were used as the immunogens for this antibody cocktail.orb248215100 ugCD1a Cocktail antibodyanti Cortical thymocyte antigen CD1A antibody, anti Epidermal dendritic cell marker CD1a antibody antibody, anti FCB6 antibody, anti HTA1 antibody, anti T cell surface antigen T6 / Leu 6 antibody, anti T-Cell Surface Glycoprotein CD1A antibody, anti CD1a antibody antibody5850Human thymus cells (O10) andrecombinant human CD1a protein (C1A/711) were used as the immunogens for this antibody cocktail.orb1798650.1 mgCD1b antibody3690A cell membrane antigen preparation that was isolated from normal human thymocytesorb301959100 ugCD1b antibody5490orb388821100 ugCD1B antibody4356Human peripheral lymphocytesorb388822100 ugCD1B antibody4356Stimulated human leukocytesorb73529100 ulCD1B antibodyanti CD1B antibody6228orb336335100 ulCD1B antibody3798A synthesized peptide derived from human CD1Borb33633550 ulCD1B antibody3258A synthesized peptide derived from human CD1Borb5598620 ugCD1b antibody3960Human peripheral lymphocytes were used as the immunogen for this CD1b antibody.orb55986100 ugCD1b antibody5850Human peripheral lymphocytes were used as the immunogen for this CD1b antibody.orb5620620 ugCD1b antibody3960Stimulated human leukocytes were used as the immunogen for the CD1b antibody.orb56206100 ugCD1b antibody5850Stimulated human leukocytes were used as the immunogen for the CD1b antibody.orb308416200 ugCD1b antibodyanti CD1b antibody, anti c antibody3780Thymus cells and Jurkat cell lineorb213682200 ulCD1B antibodyanti T-cell surface glycoprotein CD1b antibody, anti CD1b antibody4410orb213682100 ulCD1B antibodyanti T-cell surface glycoprotein CD1b antibody, anti CD1b antibody2970orb308418200 TestsCD1b antibodyanti CD1b antibody, anti c antibody3780Thymus cells and Jurkat cell lineorb165499400 ulCD1B antibodyAnti CD1B antibody, anti T-cell surface glycoprotein CD1b antibody, anti CD_antigen=CD1b antibody, anti Flags: Precursor antibody4050This CD1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 57-85 amino acids from the N-terminal region of human CD1B.orb3961450 ulCD1B antibody2520Recombinant human T-cell surface glycoprotein CD1b proteinorb39614100 ulCD1B antibody3420Recombinant human T-cell surface glycoprotein CD1b proteinorb179864100 TestsCD1b antibody (FITC)4770A cell membrane antigen preparation that was isolated from normal human thymocytesorb308417100 TestsCD1b antibody (FITC)anti CD1b antibody, anti c antibody3780Thymus cells and Jurkat cell lineorb1798670.1 mgCD1c antibody3690human thymocytesorb311187100 ulCD1C antibody4716KLH Conjugated synthetic peptideorb361558200 ugCD1C antibody6030A synthetic peptide corresponding to the N-terminus of the human CD1Corb36155850 ugCD1C antibody3420A synthetic peptide corresponding to the N-terminus of the human CD1Corb361558100 ugCD1C antibody4680A synthetic peptide corresponding to the N-terminus of the human CD1Corb31508400 ulCD1C antibodyAnti-T-cell surface glycoprotein CD1c antibody, anti-CD1C antibody4050This CD1C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the C-terminal region of human CD1C.orb5244350 ugCD1C antibody3420Recombinant Human T-cell surface glycoprotein CD1c proteinorb52443100 ugCD1C antibody5130Recombinant Human T-cell surface glycoprotein CD1c proteinorb31416650 ulCD1C antibodyanti CD1C antibody, anti BDCA1 antibody, anti CD1 antibody, anti CD1c molecule antibody, anti CD1C antigen antibody, anti c polypeptide antibody, anti CD1c antigen antibody, anti R7 antibody6660Recombinant proteinorb4137150 ulCD1C antibody2520Recombinant human T-cell surface glycoprotein CD1c proteinorb41371100 ulCD1C antibody3420Recombinant human T-cell surface glycoprotein CD1c proteinorb5244650 ugCD1C antibody (Biotin)3420Recombinant Human T-cell surface glycoprotein CD1c proteinorb52446100 ugCD1C antibody (Biotin)5130Recombinant Human T-cell surface glycoprotein CD1c proteinorb5244550 ugCD1C antibody (FITC)3420Recombinant Human T-cell surface glycoprotein CD1c proteinorb52445100 ugCD1C antibody (FITC)5130Recombinant Human T-cell surface glycoprotein CD1c proteinorb5244450 ugCD1C antibody (HRP)3420Recombinant Human T-cell surface glycoprotein CD1c proteinorb52444100 ugCD1C antibody (HRP)5130Recombinant Human T-cell surface glycoprotein CD1c proteinorb179866100 TestsCD1c antibody (PE)5670human thymocytesorb263960.2 mgCD1d antibodyCD1d, Anti-CD1d antibody, anti-CD1d Primary antibodies, anti-MAb to CD1d antibody, CD1d Primary antibodies, CD1d is a monoclonal antibody to human cds.13158Beta G2-CD1d fusion proteinorb11652100 ugCD1D antibodyanti AURKB antibody4140A synthetic peptide corresponding to a sequence at the N-terminal of human CD1Dorb73628100 ulCD1D antibodyanti CD1D antibody6228orb192332100 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody4716Recombinant protein of human CD1D.orb331214100 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody5760Synthetic peptide located within the following region: LEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVLorb228732100 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody, anti antibody3798Recombinant protein of human CD1Dorb22873220 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody, anti antibody2736Recombinant protein of human CD1Dorb22873250 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody, anti antibody3258Recombinant protein of human CD1Dorb315763200 ulCD1d antibodyanti Antigen-presenting glycoprotein CD1d antibody, anti R3G1 antibody, anti CD1d antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD1d. The exact sequence is proprietary.orb315763100 ulCD1d antibodyanti Antigen-presenting glycoprotein CD1d antibody, anti R3G1 antibody, anti CD1d antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD1d. The exact sequence is proprietary.orb140304400 ulCD1D antibodyAnti-Antigen-presenting glycoprotein CD1d antibody, anti-CD1D antibody, anti- antibody4050This CD1D antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-206 amino acids from the Central region of human CD1D.orb8933650 ugCD1D antibody6660orb9546050 ugCD1D antibody6660orb31476550 ulCD1D antibodyanti CD1D antibody, anti CD1D antigen antibody, anti d polypeptide antibody, anti R3 antibody, anti R3G1 antibody, anti CD1d antigen antibody, anti CD1d molecule antibody, anti Thymocyte antigen CD1D antibody6660Recombinant proteinorb31486050 ulCD1D antibodyanti CD1D antibody, anti CD1D antigen antibody, anti d polypeptide antibody, anti R3 antibody, anti R3G1 antibody, anti CD1d antigen antibody, anti CD1d molecule antibody, anti Thymocyte antigen CD1D antibody6660Recombinant proteinorb4830550 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody3060Recombinant protein of human CD1Dorb48305100 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody4140Recombinant protein of human CD1Dorb48305200 ulCD1D antibodyanti CD1A antibody, anti MGC34622 antibody, anti R3 antibody6480Recombinant protein of human CD1Dorb160313100 ugCD1e antibody2970Synthesized peptide derived from the Internal region of human CD1e.orb125528100 ugCD1E antibody2880Synthesized peptide derived from internal of human CD1E.orb125528200 ugCD1E antibody4140Synthesized peptide derived from internal of human CD1E.orb194991100 ulCD1E antibodyanti T-cell surface glycoprotein CD1e antibody, anti CD1e antigen antibody, anti R2G1 antibody, anti CD1E antibody4716Synthesized peptide derived from internal of human CD1E.orb311188100 ulCD1E antibody4716KLH Conjugated synthetic peptideorb227072100 ulCD1E antibodyanti T-cell surface glycoprotein CD1e antibody, anti CD1e antigen antibody, anti R2G1 antibody, anti CD1E antibody3798A synthesized peptideorb22707220 ulCD1E antibodyanti T-cell surface glycoprotein CD1e antibody, anti CD1e antigen antibody, anti R2G1 antibody, anti CD1E antibody2736A synthesized peptideorb22707250 ulCD1E antibodyanti T-cell surface glycoprotein CD1e antibody, anti CD1e antigen antibody, anti R2G1 antibody, anti CD1E antibody3258A synthesized peptideorb213683200 ulCD1E antibodyanti T-cell surface glycoprotein CD1e, membrane-associated antibody, anti hCD1e antibody, anti R2G1 antibody, anti CD1e antibody4410orb213683100 ulCD1E antibodyanti T-cell surface glycoprotein CD1e, membrane-associated antibody, anti hCD1e antibody, anti R2G1 antibody, anti CD1e antibody2970orb40647400 ulCD1E antibodyAnti-T-cell surface glycoprotein CD1e antibody, anti-soluble antibody, anti-sCD1e antibody, anti-CD_antigen=CD1e antibody, anti-R2G1 antibody, anti-T-cell surface glycoprotein CD1e antibody, anti-membrane-associated antibody, anti-hCD1e, CD1E antibody4050This CD1E antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of human CD1E.orb439280.1 mgCD2 antibodyAnti-CD2 antibody, anti-LFA-2 antibody3690orb443770.1 mgCD2 antibodyAnti-CD2 antibody, anti-LFA-2 antibody3690orb2228240.1 mgCD2 antibody3690Cytotoxic T lymphocytesorb2228250.1 mgCD2 antibody3690Cytotoxic T lymphocytesorb3021371 mlCD2 antibody14220orb76256100 ugCD2 antibodyanti beta 2 antibody4140A synthetic peptide corresponding to a sequence in the middle region of mouse CD2(224-242aa FIFCICKRRKRNRRRKDEE), different from the related rat sequence by two amino acids.orb198022100 ugCD2 antibody3600Derived from hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with T Lymphocytes activated by mixed lymphocyte culture.orb371663100 ugCD2 antibodyanti-CD2 antigen antibody, anti-CD2 molecule antibody, anti-LFA2 antibody, anti-LFA-2 antibody, anti-Rosette receptor antibody, anti-SRBC antibody, anti-T cell surface antigen CD2 antibody, anti-T11 antibody, anti-Tcell surface antigen CD2 antibody, anti-T-cell surface antigen CD2 antibody, anti-T-cell surface antigen T11 antibody, anti-P08920 antibody4860E. coli-derived mouse CD2 recombinant protein (Position: R23-S203). Mouse CD2 shares 49.7% and 73.3% amino acid (aa) sequence identity with human and rat CD2, respectively.orb382938100 ugCD2 antibody2970Recombinant peptide derived from within residues 300 aa to the C-terminus of human CD2 produced in E. coli.orb388823100 ugCD2 antibody4356Human Thymocytes/Sezary T cellsorb388824100 ugCD2 antibody4356Human Thymocytes/Sezary T cellsorb388825100 ugCD2 antibody4356Human CD2 proteinorb388826100 ugCD2 antibody4356Human thymocytesorb388827100 ugCD2 antibody4356Recombinant human LFA2 proteinorb13312100 ugCD2 antibodyanti-CD2 antibody, anti-CD2gen antibody, anti-CD2 molecule antibody, anti-LFA2 antibody, anti-LFA3 receptor antibody, anti-Lymphocyte functiongen 2 antibody, anti-p50 antibody, anti-Rosette receptor antibody, anti-Sheep erythrocyte receptor antibody, anti-Sheep red blood cell receptor antibody, anti-SRBC antibody, anti-T11 antibody2970Synthetic peptide (please contact us for details)orb13312200 ugCD2 antibodyanti-CD2 antibody, anti-CD2gen antibody, anti-CD2 molecule antibody, anti-LFA2 antibody, anti-LFA3 receptor antibody, anti-Lymphocyte functiongen 2 antibody, anti-p50 antibody, anti-Rosette receptor antibody, anti-Sheep erythrocyte receptor antibody, anti-Sheep red blood cell receptor antibody, anti-SRBC antibody, anti-T11 antibody3870Synthetic peptide (please contact us for details)orb11919100 ugCD2 antibodyanti-CD2 antibody2700orb11919500 ugCD2 antibodyanti-CD2 antibody5040orb67091100 ulCD2 antibody"anti-CD2 antibody,anti-Tcell surface antigen CD2 antibody,anti-Erythrocyte receptor antibody,anti-LFA2 antibody,anti-LFA3 receptor antibody,anti-Rosette receptor antibody,anti-Tcellsurface antigen T11 antibody,anti-Leu5 antibody,anti-SRBC antibody"6948middle region of human CD2orb255885100 ulCD2 antibody6228KLH conjugated synthetic peptideorb255887100 ulCD2 antibody6228KLH conjugated synthetic peptideorb311189100 ulCD2 antibody4716KLH Conjugated synthetic peptideorb379613100 ulCD2 antibody3960Recombinant fragment of human CD2 (AA: 25-140) expressed in E. Coli.orb379627100 ulCD2 antibody3960Recombinant fragment of human CD2 (AA: 25-140) expressed in E. Coli. orb380395100 ulCD2 antibody4716orb336906100 ulCD2 antibody3798A synthesized peptide derived from human CD2orb33690650 ulCD2 antibody3258A synthesized peptide derived from human CD2orb43932100 testsCD2 antibodyAnti-CD2 antibody, anti-LFA-2 antibody5670orb5598720 ugCD2 antibody3960Human Thymocytes/Sezary T cells were used as the immunogen for this CD2 antibody.orb55987100 ugCD2 antibody5850Human Thymocytes/Sezary T cells were used as the immunogen for this CD2 antibody.orb5598820 ugCD2 antibody3960Human Thymocytes/Sezary T cells were used as the immunogen for this CD2 antibody.orb55988100 ugCD2 antibody5850Human Thymocytes/Sezary T cells were used as the immunogen for this CD2 antibody.orb5598920 ugCD2 antibody3960Human CD2 protein was used as the immunogen for this antibody.orb55989100 ugCD2 antibody5850Human CD2 protein was used as the immunogen for this antibody.orb5620720 ugCD2 antibody3960Human thymocytes were used as the immunogen for the CD2 antibody.orb56207100 ugCD2 antibody5850Human thymocytes were used as the immunogen for the CD2 antibody.orb5620820 ugCD2 antibody3960Recombinant human protein was used as the immunogen for the CD2 antibody.orb56208100 ugCD2 antibody5850Recombinant human protein was used as the immunogen for the CD2 antibody.orb308318200 ugCD2 antibodyanti CD2 antibody, anti LFA-2 antibody3780Human thymocytesorb230436200 ugCD2 antibody6030orb23043650 ugCD2 antibody3420orb230436100 ugCD2 antibody4680orb230439200 ugCD2 antibody6030orb23043950 ugCD2 antibody3420orb230439100 ugCD2 antibody4680orb230440200 ugCD2 antibody6030orb23044050 ugCD2 antibody3420orb230440100 ugCD2 antibody4680orb230442200 ugCD2 antibody6030orb23044250 ugCD2 antibody3420orb230442100 ugCD2 antibody4680orb248897200 ulCD2 antibodyanti CD2 antibody, anti SRBC antibody, anti T-cell surface antigen CD2 antibody, anti Erythrocyte receptor antibody, anti LFA-2 antibody, anti LFA-3 receptor antibody, anti Rosette receptor antibody, anti T-cell surface antigen T11/Leu-5 antibody, anti CD antigen CD2 antibody5220orb24889750 ulCD2 antibodyanti CD2 antibody, anti SRBC antibody, anti T-cell surface antigen CD2 antibody, anti Erythrocyte receptor antibody, anti LFA-2 antibody, anti LFA-3 receptor antibody, anti Rosette receptor antibody, anti T-cell surface antigen T11/Leu-5 antibody, anti CD antigen CD2 antibody3150orb248897100 ulCD2 antibodyanti CD2 antibody, anti SRBC antibody, anti T-cell surface antigen CD2 antibody, anti Erythrocyte receptor antibody, anti LFA-2 antibody, anti LFA-3 receptor antibody, anti Rosette receptor antibody, anti T-cell surface antigen T11/Leu-5 antibody, anti CD antigen CD2 antibody3600orb308319200 TestsCD2 antibodyanti CD2 antibody, anti LFA-2 antibody3780Human thymocytesorb94521250 ulCD2 antibody6660orb23044150 ugCD2 antibody4050orb230441100 ugCD2 antibody6030orb35198950 ugCD2 antibodyanti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody3420Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb351989100 ugCD2 antibodyanti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody5130Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb36230750 ugCD2 antibody4050Recombinant human CD2 Protein orb362307100 ugCD2 antibody6030Recombinant human CD2 Protein orb22636500 ugCD2 antibodyT11, SRBC, LFA-2, LFA-3 receptor, Erythrocyte receptor, Rosette receptor3996Purified human PBL cells.orb226361 mgCD2 antibodyT11, SRBC, LFA-2, LFA-3 receptor, Erythrocyte receptor, Rosette receptor6840Purified human PBL cells.orb198246100 TestsCD2 antibody (APC)5670Derived from hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with T Lymphocytes activated by mixed lymphocyte culture.orb36251950 TestCD2 antibody (APC)4050orb362519100 TestCD2 antibody (APC)6030orb443780.1 mgCD2 antibody (Biotin)Anti-CD2 antibody, anti-LFA-2 antibody4770orb198070100 TestsCD2 antibody (Biotin)4140Derived from hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with T Lymphocytes activated by mixed lymphocyte culture.orb308320100 TestsCD2 antibody (Biotin)anti CD2 antibody, anti LFA-2 antibody3780Human thymocytesorb35199250 ugCD2 antibody (Biotin)anti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody3420Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb351992100 ugCD2 antibody (Biotin)anti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody5130Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb13847100 ugCD2 antibody (FITC)anti-CD2 antibody, anti-CD2gen antibody, anti-CD2 molecule antibody, anti-LFA2 antibody, anti-LFA3 receptor antibody, anti-Lymphocyte functiongen 2 antibody, anti-p50 antibody, anti-Rosette receptor antibody, anti-Sheep erythrocyte receptor antibody, anti-Sheep red blood cell receptor antibody, anti-SRBC antibody, anti-T11 antibody3870Synthetic peptide (please contact us for details)orb43930100 testsCD2 antibody (FITC)Anti-CD2 antibody, anti-LFA-2 antibody4770orb198069100 TestsCD2 antibody (FITC)4140Derived from hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with T Lymphocytes activated by mixed lymphocyte culture.orb308678100 TestsCD2 antibody (FITC)anti CD2 antibody, anti LFA-2 antibody3780Human thymocytesorb35199150 ugCD2 antibody (FITC)anti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody3420Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb351991100 ugCD2 antibody (FITC)anti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody5130Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb24873850 AssaysCD2 antibody (FITC)anti CD2 antibody, anti SRBC antibody, anti T-cell surface antigen CD2 antibody, anti Erythrocyte receptor antibody, anti LFA-2 antibody, anti LFA-3 receptor antibody, anti Rosette receptor antibody, anti T-cell surface antigen T11/Leu-5 antibody, anti CD antigen CD2 antibody3600orb248738100 AssaysCD2 antibody (FITC)anti CD2 antibody, anti SRBC antibody, anti T-cell surface antigen CD2 antibody, anti Erythrocyte receptor antibody, anti LFA-2 antibody, anti LFA-3 receptor antibody, anti Rosette receptor antibody, anti T-cell surface antigen T11/Leu-5 antibody, anti CD antigen CD2 antibody4770orb36134150 TestCD2 antibody (FITC)4050Recombinant human CD2 Protein orb361341100 TestCD2 antibody (FITC)6030Recombinant human CD2 Protein orb19523450 TestsCD2 antibody (FITC)4716orb1192050 TestsCD2 antibody (FITC)anti-CD2 antibody (FITC)2970orb11920100 TestsCD2 antibody (FITC)anti-CD2 antibody (FITC)3870orb23043750 TestsCD2 antibody (FITC)4050orb230437100 TestsCD2 antibody (FITC)6030orb22637500 ugCD2 antibody (FITC)T11, SRBC, LFA-2, LFA-3 receptor, Erythrocyte receptor, Rosette receptor5940Purified human PBL cells.orb226371 mgCD2 antibody (FITC)T11, SRBC, LFA-2, LFA-3 receptor, Erythrocyte receptor, Rosette receptor7020Purified human PBL cells.orb35199050 ugCD2 antibody (HRP)anti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody3420Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb351990100 ugCD2 antibody (HRP)anti-Erythrocyte receptor antibody, anti-LFA-2 antibody, anti-LFA-3 receptor antibody, anti-Rosette receptor antibody, anti-T-cell surface antigen T11/Leu-5 antibody, anti-CD2 antibody, anti-SRBC antibody5130Recombinant human T-cell surface antigen CD2 protein(25-209AA)orb43931100 testsCD2 antibody (PE)Anti-CD2 antibody, anti-LFA-2 antibody5670orb44379100 testsCD2 antibody (PE)Anti-CD2 antibody, anti-LFA-2 antibody5670orb198125100 TestsCD2 antibody (PE)4590Derived from hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with T Lymphocytes activated by mixed lymphocyte culture.orb222826100 testsCD2 antibody (PE)5670Cytotoxic T lymphocytesorb308679100 TestsCD2 antibody (PE)anti CD2 antibody, anti LFA-2 antibody4230Human thymocytesorb36134250 TestCD2 antibody (PE)4050Recombinant human CD2 Protein orb361342100 TestCD2 antibody (PE)6030Recombinant human CD2 Protein orb23043850 TestsCD2 antibody (PE)4050orb230438100 TestsCD2 antibody (PE)6030orb194089100 ulCD2 Tail-binding antibodyanti CD2 antigen cytoplasmic tail-binding 2 antibody, anti CD2 cytoplasmic domain-binding antibody, anti CD2 tail-binding antibody, anti CD2B2 antibody, anti LIN1 antibody4716Synthesized peptide derived from internal of human CD2 Tail-binding.orb337440100 ulCD2 Tail-binding antibody3798A synthesized peptide derived from human CD2 Tail-bindingorb33744050 ulCD2 Tail-binding antibody3258A synthesized peptide derived from human CD2 Tail-bindingorb198267100 TestsCD2, CD19 antibody (FITC, PE)6120CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.orb19814150 TestsCD2, CD19 antibody (FITC, PE)4590CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.orb198268100 TestsCD2, CD20 antibody (FITC, PE)6120CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture. CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells froorb19814250 TestsCD2, CD20 antibody (FITC, PE)4590CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells fromorb198309100 TestsCD2, CD4 antibody (FITC, PE)anti CD 4 antibody (FITC/PE), anti CD4 (L3T4) antibody (FITC/PE), anti CD4 antibody (FITC/PE), anti CD4 antigen (p55) antibody (FITC/PE), anti CD4 Antigen antibody (FITC/PE), anti CD4 molecule antibody (FITC/PE), anti CD4 Receptor antibody (FITC/PE), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE), anti CD4mut antibody (FITC/PE), anti L3T4 antibody (FITC/PE), anti Leu3 antibody (FITC/PE), anti Ly-4 antibody (FITC/PE), anti Lymphocyte antigen CD4 antibody (FITC/PE), anti T Cell Antigen T4 antibody (FITC/PE), anti T cell antigen T4/LEU3 antibody (FITC/PE), anti T cell differentiation antigen L3T4 antibody (FITC/PE), anti T cell OKT4 deficiency, included antibody (FITC/PE), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE), anti T cell surface antigen T4/Leu3 antibody (FITC/PE), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE), anti T-cell surface glycoprotein CD4 antibody (FITC/PE), anti W3/25 antibody (FITC/PE), anti W3/25 antigen antibody (FITC/PE)6120CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.CD4: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells from Borb19820650 TestsCD2, CD4 antibody (FITC, PE)anti CD 4 antibody (FITC/PE), anti CD4 (L3T4) antibody (FITC/PE), anti CD4 antibody (FITC/PE), anti CD4 antigen (p55) antibody (FITC/PE), anti CD4 Antigen antibody (FITC/PE), anti CD4 molecule antibody (FITC/PE), anti CD4 Receptor antibody (FITC/PE), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE), anti CD4mut antibody (FITC/PE), anti L3T4 antibody (FITC/PE), anti Leu3 antibody (FITC/PE), anti Ly-4 antibody (FITC/PE), anti Lymphocyte antigen CD4 antibody (FITC/PE), anti T Cell Antigen T4 antibody (FITC/PE), anti T cell antigen T4/LEU3 antibody (FITC/PE), anti T cell differentiation antigen L3T4 antibody (FITC/PE), anti T cell OKT4 deficiency, included antibody (FITC/PE), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE), anti T cell surface antigen T4/Leu3 antibody (FITC/PE), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE), anti T-cell surface glycoprotein CD4 antibody (FITC/PE), anti W3/25 antibody (FITC/PE), anti W3/25 antigen antibody (FITC/PE)4590CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture. CD4: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells from orb198263100 TestsCD2, CD7 antibody (FITC, PE)6120CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture. CD7: Derived from the hybridization of mouse P3-X63-Ag8.653 myeloma cells with spleen corb19812650 TestsCD2, CD7 antibody (FITC, PE)4590CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture. CD7: Derived from the hybridization of mouse P3-X63-Ag8.653 myeloma cells with spleen corb19814950 TestsCD2, CDHLADR antibody (FITC, PE)4590CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture.orb198269100 TestsCD2, HLA, DR antibody (FITC, PE)6120CD2: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with t lymphocytes activated by mixed lymphocyte culture. HLA-DR: Derived from the hybridization of mouse NS-1/1-Ag4 myeloma cells with spleen ceorb38598620 ugCD20 (B-cell marker) antibody3960Recombinant human CD20 protein was used as the immunogen for this CD20 antibody.orb385986100 ugCD20 (B-cell marker) antibody5850Recombinant human CD20 protein was used as the immunogen for this CD20 antibody.orb439370.1 mgCD20 antibodyAnti-CD20 antibody3690orb442650.1 mgCD20 antibodyAnti-CD20 antibody3690orb444180.1 mgCD20 antibodyAnti-CD20 antibody3690orb444190.1 mgCD20 antibodyAnti-CD20 antibody3690orb446410.1 mgCD20 antibodyAnti-CD20 antibody3690orb984820.1 mgCD20 antibody5670orb272611 mlCD20 antibodyCD20 (L26), B Cells, human7020B-Cells from human Tonsilsorb984831 mlCD20 antibody4140orb3018941 mlCD20 antibody4860orb3021381 mlCD20 antibody6120orb3027621 mlCD20 antibody14310orb3027801 mlCD20 antibody12150orb10307100 ugCD20 antibodyanti-APY antibody, anti-ATOPY antibody, anti-B1 antibody, anti-Bp35 antibody, anti-CD20 antibody, anti-Fc epsilon receptor I beta chain antibody, anti-Fc Fragment of IgE high affinity I receptor for beta polypeptide antibody, anti-FCER1B antibody, anti-FCERI antibody, anti-High affinity immunoglobulin epsilon receptor subunit beta antibody, anti-IgE F antibody, anti-IgE Fc receptor subunit beta antibody, anti-IGEL antibody, anti-IGER antibody, anti-IGHER antibody, anti-LEU-16 antibody, anti-Ly44 antibody, anti-Membrane spanning 4 domains subfamily A member 2 antibody, anti-MGC3969 antibody, anti-MS4A1 antibody, anti-MS4A2 antibody, anti-S7 antibody3330orb160314100 ugCD20 antibody2970Synthesized peptide derived from the C-terminal region of human CD20.orb198035100 ugCD20 antibody3600CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with the LB lymphoblastoid cell line.orb301841100 ugCD20 antibody5850orb378213100 ugCD20 antibody3870Human lymphoblastoid cell line SBorb396140100 ugCD20 antibody3870Human lymphoblastoid cell line SB.orb1146100 ugCD20 antibodyanti CD20 antibody2970Synthetic peptide (please contact us for details)orb1146200 ugCD20 antibodyanti CD20 antibody3870Synthetic peptide (please contact us for details)orb317568100 ugCD20 antibodyanti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti MS4A1 antibody, anti CD20 antibody, anti CD20_HUMAN antibody3330KLH conjugated synthetic peptide derived from human CD20orb317568200 ugCD20 antibodyanti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti MS4A1 antibody, anti CD20 antibody, anti CD20_HUMAN antibody4500KLH conjugated synthetic peptide derived from human CD20orb11996100 ugCD20 antibodyanti-CD20 antibody2700orb11996500 ugCD20 antibodyanti-CD20 antibody5040orb67092100 ulCD20 antibody"anti-CD20 antibody,anti-Blymphocyte antigen CD20 antibody,anti-Blymphocyte surface antigen B1 antibody,anti-Bp35 antibody,anti-Leukocyte surface antigen Leu16 antibody,anti-Membranespanning 4domains subfamily A member 1 antibody,anti-CD20 antibody,anti-MS4A1 antibody"6948middle region of human CD20orb88348100 ulCD20 antibody6660orb97529100 ulCD20 antibodyanti B1 antibody, anti S7 antibody, anti Bp35 antibody, anti CD20 antibody, anti MS4A2 antibody, anti LEU-16 antibody, anti MGC3969 antibody, anti MS4A1 antibody3960Synthetic peptide corresponding to aa of human CD20,conjugated to KLH.orb254344100 ulCD20 antibody4716KLH conjugated synthetic peptideorb255846100 ulCD20 antibody6228KLH conjugated synthetic peptideorb311488100 ulCD20 antibody4716KLH Conjugated synthetic peptideorb394324100 ulCD20 antibody3798Recombinant fragment of human CD20 expressed in E. Coliorb39432450 ulCD20 antibody3258Recombinant fragment of human CD20 expressed in E. Coliorb385679100 ulCD20 antibody3960Human tonsil B cells were used as the immunogen for this CD20 antibody.orb385679500 ulCD20 antibody5850Human tonsil B cells were used as the immunogen for this CD20 antibody.orb385684100 ulCD20 antibody3960Human tonsil B cells were used as the immunogen for this CD20 antibody.orb385684500 ulCD20 antibody5850Human tonsil B cells were used as the immunogen for this CD20 antibody.orb43941100 testsCD20 antibodyAnti-CD20 antibody5670orb88311125 ulCD20 antibody6660orb24824120 ugCD20 antibodyanti APY antibody, anti ATOPY antibody, anti B-lymphocyte cell-surface antigen B1 antibody, anti Bp35 antibody, anti LEU16 antibody, anti Leukocyte surface antigen Leu-16 antibody3960The lymphoblastoid cell line Daudi was used as the immunogen for this CD20 antibody.orb248241100 ugCD20 antibodyanti APY antibody, anti ATOPY antibody, anti B-lymphocyte cell-surface antigen B1 antibody, anti Bp35 antibody, anti LEU16 antibody, anti Leukocyte surface antigen Leu-16 antibody5850The lymphoblastoid cell line Daudi was used as the immunogen for this CD20 antibody.orb38567820 ugCD20 antibody3960Recombinant human MS4A1/CD20 protein was used as the immunogen for this anti-CD20 antibody.orb385678100 ugCD20 antibody5850Recombinant human MS4A1/CD20 protein was used as the immunogen for this anti-CD20 antibody.orb38568120 ugCD20 antibody3960Stimulated human leukocytes were used as the immunogen for this CD20 antibody.orb385681100 ugCD20 antibody5850Stimulated human leukocytes were used as the immunogen for this CD20 antibody.orb38568320 ugCD20 antibody3960Stimulated human leukocytes were used as the immunogen for this CD20 antibody.orb385683100 ugCD20 antibody5850Stimulated human leukocytes were used as the immunogen for this CD20 antibody.orb38568520 ugCD20 antibody3960Recombinant CD20 protein was used as the immunogen for this CD20 antibody.orb385685100 ugCD20 antibody5850Recombinant CD20 protein was used as the immunogen for this CD20 antibody.orb38584620 ugCD20 antibody3960Recombinant CD20 protein was used as the immunogen for this CD20 antibody.orb385846100 ugCD20 antibody5850Recombinant CD20 protein was used as the immunogen for this CD20 antibody.orb38619020 ugCD20 antibody3960Human CD20 protein was used as the immunogen for this reccombinant CD20 antibody.orb386190100 ugCD20 antibody5850Human CD20 protein was used as the immunogen for this reccombinant CD20 antibody.orb38622220 ugCD20 antibody4500Full length human CD20 protein was used as the immunogen for this reccombinant CD20 antibody.orb386222100 ugCD20 antibody6570Full length human CD20 protein was used as the immunogen for this reccombinant CD20 antibody.orb38622320 ugCD20 antibody4500Full length human CD20 protein was used as the immunogen for this reccombinant CD20 antibody.orb386223100 ugCD20 antibody6570Full length human CD20 protein was used as the immunogen for this reccombinant CD20 antibody.orb308452200 ugCD20 antibodyanti CD20 antibody3780Chronic Lymphoid Leukaemia cells (CLL)orb230450200 ugCD20 antibody6030orb23045050 ugCD20 antibody3420orb230450100 ugCD20 antibody4680orb361849200 ugCD20 antibody6030Recombinant human CD20/MS4A1 Protein orb36184950 ugCD20 antibody3420Recombinant human CD20/MS4A1 Protein orb361849100 ugCD20 antibody4680Recombinant human CD20/MS4A1 Protein orb361850200 ugCD20 antibody6030Recombinant human CD20/MS4A1 Protein orb36185050 ugCD20 antibody3420Recombinant human CD20/MS4A1 Protein orb361850100 ugCD20 antibody4680Recombinant human CD20/MS4A1 Protein orb256695200 ulCD20 antibodyanti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD20 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD20. The exact sequence is proprietary.orb256695100 ulCD20 antibodyanti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD20 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD20. The exact sequence is proprietary.orb248898200 ulCD20 antibodyanti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody5220orb24889850 ulCD20 antibodyanti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody3150orb248898100 ulCD20 antibodyanti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody3600orb308453200 TestsCD20 antibodyanti CD20 antibody3780Chronic Lymphoid Leukaemia cells (CLL)orb230449400 ugCD20 antibody6030orb230449100 ugCD20 antibody3420orb230449200 ugCD20 antibody4680orb231828400 ugCD20 antibody6030orb231828100 ugCD20 antibody3420orb231828200 ugCD20 antibody4680orb272455 ml (RTU)CD20 antibodyCD20 (L26), B Cells, human4122B-Cells from human Tonsilsorb8847550 ugCD20 antibody6660orb23044650 ugCD20 antibody4050orb230446100 ugCD20 antibody6030orb19144350 ugCD20 antibodyB1, S7, Bp35, MS4A2, LEU-16, MGC39693690orb191443500 ugCD20 antibodyB1, S7, Bp35, MS4A2, LEU-16, MGC396915552orb17881450 ulCD20 antibodyanti MS4A1 antibody, anti B-lymphocyte antigen CD20 antibody, anti B1 antibody, anti Bp35 antibody, anti CD20 antibody, anti CD20 antigen antibody, anti CD20 receptor antibody, anti LEU-16 antibody, anti CVID5 antibody6660Full length human recombinant protein of human MS4A1 produced in HEK293T cell.orb178420500 ulCD20 antibody6552peptide derived from C-terminal sequence of human CD 20orb1784201 mlCD20 antibody10350peptide derived from C-terminal sequence of human CD 20orb178420100 ulCD20 antibody4842peptide derived from C-terminal sequence of human CD 20orb178420200 ulCD20 antibody6678peptide derived from C-terminal sequence of human CD 20orb154440100 TestsCD20 antibody (APC)5670Human tonsillar B cellsorb24871150 AssaysCD20 antibody (APC)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody4050orb248711100 AssaysCD20 antibody (APC)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody5940orb1200150 TestsCD20 antibody (APC)anti-CD20 antibody (APC)2970orb12001100 TestsCD20 antibody (APC)anti-CD20 antibody (APC)4050orb23044750 TestsCD20 antibody (APC)4050orb230447100 TestsCD20 antibody (APC)6030orb439380.1 mgCD20 antibody (Biotin)Anti-CD20 antibody4770orb446420.1 mgCD20 antibody (Biotin)Anti-CD20 antibody4770orb15284100 ugCD20 antibody (FITC)MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B1; S7; BP35; CD20; LEU-16; MGC3969; CD20 antigen; CD20 receptor; B-lymphocyte cell-surface antigen B13870Synthetic peptide (please contact us for details)orb3176100 ugCD20 antibody (FITC)anti CD20 antibody (FITC)3870Synthetic peptide (please contact us for details)orb318079100 ugCD20 antibody (FITC)anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti MS4A1 antibody, anti CD20 antibody, anti CD20_HUMAN antibody3870KLH conjugated synthetic peptide derived from human CD20orb360781100 ugCD20 antibody (FITC)anti-APY antibody, anti-ATOPY antibody, anti-B1 antibody, anti-Bp35 antibody, anti-CD20 antibody, anti-Fc epsilon receptor I beta chain antibody, anti-Fc Fragment of IgE high affinity I receptor for beta polypeptide antibody, anti-FCER1B antibody, anti-FCERI antibody, anti-High affinity immunoglobulin epsilon receptor subunit beta antibody, anti-IgE F antibody, anti-IgE Fc receptor subunit beta antibody, anti-IGEL antibody, anti-IGER antibody, anti-IGHER antibody, anti-LEU-16 antibody, anti-Ly44 antibody, anti-Membrane spanning 4 domains subfamily A member 2 antibody, anti-MGC3969 antibody, anti-MS4A1 antibody, anti-MS4A2 antibody, anti-S7 antibody3330Synthetic peptide (please contact us for details)orb43939100 testsCD20 antibody (FITC)Anti-CD20 antibody4770orb44643100 testsCD20 antibody (FITC)Anti-CD20 antibody4770orb198090100 TestsCD20 antibody (FITC)4140CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with the LB lymphoblastoid cell line.orb308694100 TestsCD20 antibody (FITC)anti CD20 antibody3780Chronic Lymphoid Leukaemia cells (CLL)orb24873950 AssaysCD20 antibody (FITC)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody3600orb248739100 AssaysCD20 antibody (FITC)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody4770orb1199750 TestsCD20 antibody (FITC)anti-CD20 antibody (FITC)2970orb11997100 TestsCD20 antibody (FITC)anti-CD20 antibody (FITC)3870orb17065950 TestsCD20 antibody (FITC)anti MS4A1 antibody4050Human CD20 Transfected CHO Cells. This antibody was obtained from a rabbit immunized with purified, Human CD20 Transfected CHO Cells and conjugated with FITC under optimum conditions, the unreacted FITC was removed.orb170659100 TestsCD20 antibody (FITC)anti MS4A1 antibody6030Human CD20 Transfected CHO Cells. This antibody was obtained from a rabbit immunized with purified, Human CD20 Transfected CHO Cells and conjugated with FITC under optimum conditions, the unreacted FITC was removed.orb198272100 TestsCD20 antibody (FITC, PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with the LB orb19815250 TestsCD20 antibody (FITC, PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with the LB lorb44644100 testsCD20 antibody (PE)Anti-CD20 antibody5670orb179868100 TestsCD20 antibody (PE)6300Human tonsillar B cellsorb198140100 TestsCD20 antibody (PE)4590CD20: Derived from the hybridization of mouse Sp2/0 myeloma cells with spleen cells from BALB/c mice immunized with the LB lymphoblastoid cell line.orb308695100 TestsCD20 antibody (PE)anti CD20 antibody4230Chronic Lymphoid Leukaemia cells (CLL)orb386253100 TestsCD20 antibody (PE)6570The lymphoblastoid cell line Daudi was used as the immunogen for this CD20 antibody.orb24881150 AssaysCD20 antibody (PE)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody4050orb248811100 AssaysCD20 antibody (PE)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody5940orb1199950 TestsCD20 antibody (PE)anti-CD20 antibody (PE)2970orb11999100 TestsCD20 antibody (PE)anti-CD20 antibody (PE)4050orb23044850 TestsCD20 antibody (PE)4050orb230448100 TestsCD20 antibody (PE)6030orb24886550 AssaysCD20 antibody (PE-Cy5)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody4050orb248865100 AssaysCD20 antibody (PE-Cy5)anti MS4A1 antibody, anti CD20 antibody, anti B-lymphocyte antigen CD20 antibody, anti B-lymphocyte surface antigen B1 antibody, anti Bp35 antibody, anti Leukocyte surface antigen Leu-16 antibody, anti Membrane-spanning 4-domains subfamily A member 1 antibody, anti CD antigen CD20 antibody5940orb1200050 TestsCD20 antibody (PE-Cy5)anti-CD20 antibody (PE-Cy5)3330orb12000100 TestsCD20 antibody (PE-Cy5)anti-CD20 antibody (PE-Cy5)4410orb44645100 testsCD20 antibody (PerCP)Anti-CD20 antibody5670orb36252550 TestCD20 antibody (PerCP)4050orb362525100 TestCD20 antibody (PerCP)6030orb385680100 ulCD20 Cocktail antibody3960Human tonsil B cells (L26) and recombinant protein (IGEL/733) were used as the immunogen for this CD20 antibody cocktail.orb385680500 ulCD20 Cocktail antibody5850Human tonsil B cells (L26) and recombinant protein (IGEL/733) were used as the immunogen for this CD20 antibody cocktail.orb3023620.1 mgCD200 antibody9090orb229799100 ugCD200 antibodyanti MRC antibody, anti MOX1 antibody, anti MOX2 antibody, anti OX-2 antibody3960Purified recombinant fragment of human CD200 expressed in E. Coli.orb100118100 ugCD200 antibodyAnti-CD200 antibody, anti-CD200 antigen antibody, anti-CD200 molecule antibody, anti-MOX1 antibody, anti-MOX2 antibody, anti-MRC antibody, anti-MRC OX 2 antigen antibody, anti-My033 antibody, anti-OX 2 antibody, anti-OX 2 membrane glycoprotein precursor antibody, anti-OX-2 membrane glycoprotein antibody, anti-OX2G antibody, anti-OX2G_HUMAN. antibody3330orb100118200 ugCD200 antibodyAnti-CD200 antibody, anti-CD200 antigen antibody, anti-CD200 molecule antibody, anti-MOX1 antibody, anti-MOX2 antibody, anti-MRC antibody, anti-MRC OX 2 antigen antibody, anti-My033 antibody, anti-OX 2 antibody, anti-OX 2 membrane glycoprotein precursor antibody, anti-OX-2 membrane glycoprotein antibody, anti-OX2G antibody, anti-OX2G_HUMAN. antibody4500orb42133100 ugCD200 antibodyanti-CD200 / OX-2 antibody6030Recombinant human CD200 protein .orb4213350 ugCD200 antibodyanti-CD200 / OX-2 antibody4050Recombinant human CD200 protein .orb42131100 ugCD200 antibodyanti-CD200 / Mox2 / OX-2 antibody4680Recombinant mouse CD200 protein.orb4213150 ugCD200 antibodyanti-CD200 / Mox2 / OX-2 antibody3420Recombinant mouse CD200 protein.orb42131200 ugCD200 antibodyanti-CD200 / Mox2 / OX-2 antibody6030Recombinant mouse CD200 protein.orb42132100 ugCD200 antibodyanti-CD200 / OX-2 antibody4680Recombinant human CD200 protein .orb4213250 ugCD200 antibodyanti-CD200 / OX-2 antibody3420Recombinant human CD200 protein .orb42132200 ugCD200 antibodyanti-CD200 / OX-2 antibody6030Recombinant human CD200 protein .orb311387100 ulCD200 antibody4716KLH Conjugated synthetic peptideorb336340100 ulCD200 antibody3798A synthesized peptide derived from human CD200orb33634050 ulCD200 antibody3258A synthesized peptide derived from human CD200orb42129200 ugCD200 antibodyanti-CD200 / OX-2 antibody4680Recombinant human CD200 protein .orb42129100 ugCD200 antibodyanti-CD200 / OX-2 antibody3420Recombinant human CD200 protein .orb42129400 ugCD200 antibodyanti-CD200 / OX-2 antibody6030Recombinant human CD200 protein .orb42130200 ugCD200 antibodyanti-CD200 / Mox2 / OX-2 antibody4680Recombinant mouse CD200 protein.orb42130100 ugCD200 antibodyanti-CD200 / Mox2 / OX-2 antibody3420Recombinant mouse CD200 protein.orb42130400 ugCD200 antibodyanti-CD200 / Mox2 / OX-2 antibody6030Recombinant mouse CD200 protein.orb230392200 ugCD200 antibody6030orb23039250 ugCD200 antibody3420orb230392100 ugCD200 antibody4680orb230393200 ugCD200 antibody6030orb23039350 ugCD200 antibody3420orb230393100 ugCD200 antibody4680orb361830200 ugCD200 antibody6030Recombinant human CD200 Protein orb36183050 ugCD200 antibody3420Recombinant human CD200 Protein orb361830100 ugCD200 antibody4680Recombinant human CD200 Protein orb373419200 ulCD200 antibody6480Recombinant protein of human CD200orb37341950 ulCD200 antibody3060Recombinant protein of human CD200orb373419100 ulCD200 antibody4140Recombinant protein of human CD200orb164938400 ulCD200 antibodyAnti CD200 antibody, anti MOX1 antibody, anti MOX2 antibody, anti OX-2 membrane glycoprotein antibody, anti CD_antigen=CD200 antibody, anti Flags: Precursor antibody4050This CD200 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the C-terminal region of human CD200.orb17065050 ugCD200 antibody4050Recombinant Mouse CD200 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD200orb170650100 ugCD200 antibody6030Recombinant Mouse CD200 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD200orb23039150 ugCD200 antibody4050orb230391100 ugCD200 antibody6030orb4002950 ulCD200 antibody2520Recombinant human OX-2 membrane glycoproteinorb40029100 ulCD200 antibody3420Recombinant human OX-2 membrane glycoproteinorb4003050 ulCD200 antibody2520Recombinant human OX-2 membrane glycoproteinorb40030100 ulCD200 antibody3420Recombinant human OX-2 membrane glycoproteinorb111552100 ulCD200 antibody (Alexa 488)"CD200 antibody (Alexa 488), CD200 antigen antibody (Alexa 488), CD200 molecule antibody (Alexa 488), MOX1 antibody (Alexa 488), MOX2 antibody (Alexa 488), MRC antibody (Alexa 488), MRC OX 2 antigen antibody (Alexa 488), My033 antibody (Alexa 488), OX 2 antibody (Alexa 488), OX 2 membrane glycoprotein precursor antibody (Alexa 488), OX-2 membrane glycoprotein antibody (Alexa 488), OX2G antibody (Alexa 488), OX2G_HUMAN. antibody (Alexa 488)"3870orb111060100 ulCD200 antibody (Alexa Fluor 350)"CD200 antibody (Alexa Fluor 350), CD200 antigen antibody (Alexa Fluor 350), CD200 molecule antibody (Alexa Fluor 350), MOX1 antibody (Alexa Fluor 350), MOX2 antibody (Alexa Fluor 350), MRC antibody (Alexa Fluor 350), MRC OX 2 antigen antibody (Alexa Fluor 350), My033 antibody (Alexa Fluor 350), OX 2 antibody (Alexa Fluor 350), OX 2 membrane glycoprotein precursor antibody (Alexa Fluor 350), OX-2 membrane glycoprotein antibody (Alexa Fluor 350), OX2G antibody (Alexa Fluor 350), OX2G_HUMAN. antibody (Alexa Fluor 350)"3870orb113521100 ulCD200 antibody (Alkaline Phosphatase)"CD200 antibody (Alkaline Phosphatase), CD200 antigen antibody (Alkaline Phosphatase), CD200 molecule antibody (Alkaline Phosphatase), MOX1 antibody (Alkaline Phosphatase), MOX2 antibody (Alkaline Phosphatase), MRC antibody (Alkaline Phosphatase), MRC OX 2 antigen antibody (Alkaline Phosphatase), My033 antibody (Alkaline Phosphatase), OX 2 antibody (Alkaline Phosphatase), OX 2 membrane glycoprotein precursor antibody (Alkaline Phosphatase), OX-2 membrane glycoprotein antibody (Alkaline Phosphatase), OX2G antibody (Alkaline Phosphatase), OX2G_HUMAN. antibody (Alkaline Phosphatase)"3870orb154461100 TestsCD200 antibody (APC)5670Human CD200orb23137950 TestsCD200 antibody (APC)4050orb231379100 TestsCD200 antibody (APC)6030orb3023630.1 mgCD200 antibody (Biotin)9810orb114014100 ulCD200 antibody (Biotin)"CD200 antibody (Biotin), CD200 antigen antibody (Biotin), CD200 molecule antibody (Biotin), MOX1 antibody (Biotin), MOX2 antibody (Biotin), MRC antibody (Biotin), MRC OX 2 antigen antibody (Biotin), My033 antibody (Biotin), OX 2 antibody (Biotin), OX 2 membrane glycoprotein precursor antibody (Biotin), OX-2 membrane glycoprotein antibody (Biotin), OX2G antibody (Biotin), OX2G_HUMAN. antibody (Biotin)"3870orb114506100 ulCD200 antibody (Cy3)"CD200 antibody (Cy3), CD200 antigen antibody (Cy3), CD200 molecule antibody (Cy3), MOX1 antibody (Cy3), MOX2 antibody (Cy3), MRC antibody (Cy3), MRC OX 2 antigen antibody (Cy3), My033 antibody (Cy3), OX 2 antibody (Cy3), OX 2 membrane glycoprotein precursor antibody (Cy3), OX-2 membrane glycoprotein antibody (Cy3), OX2G antibody (Cy3), OX2G_HUMAN. antibody (Cy3)"3870orb114998100 ulCD200 antibody (Cy5)"CD200 antibody (Cy5), CD200 antigen antibody (Cy5), CD200 molecule antibody (Cy5), MOX1 antibody (Cy5), MOX2 antibody (Cy5), MRC antibody (Cy5), MRC OX 2 antigen antibody (Cy5), My033 antibody (Cy5), OX 2 antibody (Cy5), OX 2 membrane glycoprotein precursor antibody (Cy5), OX-2 membrane glycoprotein antibody (Cy5), OX2G antibody (Cy5), OX2G_HUMAN. antibody (Cy5)"3870orb123039100 ulCD200 antibody (Cy5.5)"CD200 antibody (Cy5.5), CD200 antigen antibody (Cy5.5), CD200 molecule antibody (Cy5.5), MOX1 antibody (Cy5.5), MOX2 antibody (Cy5.5), MRC antibody (Cy5.5), MRC OX 2 antigen antibody (Cy5.5), My033 antibody (Cy5.5), OX 2 antibody (Cy5.5), OX 2 membrane glycoprotein precursor antibody (Cy5.5), OX-2 membrane glycoprotein antibody (Cy5.5), OX2G antibody (Cy5.5), OX2G_HUMAN. antibody (Cy5.5)"3870orb123531100 ulCD200 antibody (Cy7)"CD200 antibody (Cy7), CD200 antigen antibody (Cy7), CD200 molecule antibody (Cy7), MOX1 antibody (Cy7), MOX2 antibody (Cy7), MRC antibody (Cy7), MRC OX 2 antigen antibody (Cy7), My033 antibody (Cy7), OX 2 antibody (Cy7), OX 2 membrane glycoprotein precursor antibody (Cy7), OX-2 membrane glycoprotein antibody (Cy7), OX2G antibody (Cy7), OX2G_HUMAN. antibody (Cy7)"3870orb3023640.1 mgCD200 antibody (FITC)8550orb102268100 ugCD200 antibody (FITC)"Anti-CD200 antibody, anti-CD200 antigen antibody, anti-CD200 molecule antibody, anti-MOX1 antibody, anti-MOX2 antibody, anti-MRC antibody, anti-MRC OX 2 antigen antibody, anti-My033 antibody, anti-OX 2 antibody, anti-OX 2 membrane glycoprotein precursor antibody, anti-OX-2 membrane glycoprotein antibody, anti-OX2G antibody, anti-OX2G_HUMAN. antibody"3870orb110074100 ulCD200 antibody (HRP)"CD200 antibody (HRP), CD200 antigen antibody (HRP), CD200 molecule antibody (HRP), MOX1 antibody (HRP), MOX2 antibody (HRP), MRC antibody (HRP), MRC OX 2 antigen antibody (HRP), My033 antibody (HRP), OX 2 antibody (HRP), OX 2 membrane glycoprotein precursor antibody (HRP), OX-2 membrane glycoprotein antibody (HRP), OX2G antibody (HRP), OX2G_HUMAN. antibody (HRP)"3870orb154533100 TestsCD200 antibody (PE )5670Human CD200orb124515100 ulCD200 antibody (PE)"CD200 antibody (PE), CD200 antigen antibody (PE), CD200 molecule antibody (PE), MOX1 antibody (PE), MOX2 antibody (PE), MRC antibody (PE), MRC OX 2 antigen antibody (PE), My033 antibody (PE), OX 2 antibody (PE), OX 2 membrane glycoprotein precursor antibody (PE), OX-2 membrane glycoprotein antibody (PE), OX2G antibody (PE), OX2G_HUMAN. antibody (PE)"3870orb36111250 TestCD200 antibody (PE)4050Recombinant human CD200 Protein orb361112100 TestCD200 antibody (PE)6030Recombinant human CD200 Protein orb17148150 TestsCD200 antibody (PE)4050Recombinant Mouse CD200 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD200orb171481100 TestsCD200 antibody (PE)6030Recombinant Mouse CD200 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD200orb125292100 ulCD200 antibody (PE-Cy3)"CD200 antibody (PE-Cy3), CD200 antigen antibody (PE-Cy3), CD200 molecule antibody (PE-Cy3), MOX1 antibody (PE-Cy3), MOX2 antibody (PE-Cy3), MRC antibody (PE-Cy3), MRC OX 2 antigen antibody (PE-Cy3), My033 antibody (PE-Cy3), OX 2 antibody (PE-Cy3), OX 2 membrane glycoprotein precursor antibody (PE-Cy3), OX-2 membrane glycoprotein antibody (PE-Cy3), OX2G antibody (PE-Cy3), OX2G_HUMAN. antibody (PE-Cy3)"3870orb129794100 ulCD200 antibody (PE-Cy5)"CD200 antibody (PE-Cy5), CD200 antigen antibody (PE-Cy5), CD200 molecule antibody (PE-Cy5), MOX1 antibody (PE-Cy5), MOX2 antibody (PE-Cy5), MRC antibody (PE-Cy5), MRC OX 2 antigen antibody (PE-Cy5), My033 antibody (PE-Cy5), OX 2 antibody (PE-Cy5), OX 2 membrane glycoprotein precursor antibody (PE-Cy5), OX-2 membrane glycoprotein antibody (PE-Cy5), OX2G antibody (PE-Cy5), OX2G_HUMAN. antibody (PE-Cy5)"3870orb130286100 ulCD200 antibody (PE-Cy5.5)"CD200 antibody (PE-Cy5.5), CD200 antigen antibody (PE-Cy5.5), CD200 molecule antibody (PE-Cy5.5), MOX1 antibody (PE-Cy5.5), MOX2 antibody (PE-Cy5.5), MRC antibody (PE-Cy5.5), MRC OX 2 antigen antibody (PE-Cy5.5), My033 antibody (PE-Cy5.5), OX 2 antibody (PE-Cy5.5), OX 2 membrane glycoprotein precursor antibody (PE-Cy5.5), OX-2 membrane glycoprotein antibody (PE-Cy5.5), OX2G antibody (PE-Cy5.5), OX2G_HUMAN. antibody (PE-Cy5.5)"3870orb130778100 ulCD200 antibody (PE-Cy7)"CD200 antibody (PE-Cy7), CD200 antigen antibody (PE-Cy7), CD200 molecule antibody (PE-Cy7), MOX1 antibody (PE-Cy7), MOX2 antibody (PE-Cy7), MRC antibody (PE-Cy7), MRC OX 2 antigen antibody (PE-Cy7), My033 antibody (PE-Cy7), OX 2 antibody (PE-Cy7), OX 2 membrane glycoprotein precursor antibody (PE-Cy7), OX-2 membrane glycoprotein antibody (PE-Cy7), OX2G antibody (PE-Cy7), OX2G_HUMAN. antibody (PE-Cy7)"3870orb131270100 ulCD200 antibody (RBITC)"CD200 antibody (RBITC), CD200 antigen antibody (RBITC), CD200 molecule antibody (RBITC), MOX1 antibody (RBITC), MOX2 antibody (RBITC), MRC antibody (RBITC), MRC OX 2 antigen antibody (RBITC), My033 antibody (RBITC), OX 2 antibody (RBITC), OX 2 membrane glycoprotein precursor antibody (RBITC), OX-2 membrane glycoprotein antibody (RBITC), OX2G antibody (RBITC), OX2G_HUMAN. antibody (RBITC)"3870orb3025230.2 mgCD200r antibody11700orb348844100 ugCD200R antibody3870Recombinant proteinorb348904100 ugCD200R antibody3870Recombinant proteinorb156302100 ugCD200R antibodyanti-CD 200R antibody, anti-CD200 cell surface glycoprotein receptor antibody, anti-CD200 receptor 1 antibody, anti-Cd200r1 antibody, anti-Cell surface glycoprotein CD200 receptor 1 antibody, anti-Cell surface glycoprotein OX2 receptor 1 antibody, anti-Cell surface glycoprotein OX2 receptor antibody, anti-cell surface glycoprotein receptor CD200 antibody, anti-CRTR 2 antibody, anti-CRTR2 antibody, anti-HCRTR2 antibody, anti-MO2R1_HUMAN antibody, anti-MOX2 receptor antibody, anti-MOX2R antibody, anti-OX2R antibody2970KLH conjugated synthetic peptide derived from human CD200Rorb156302200 ugCD200R antibodyanti-CD 200R antibody, anti-CD200 cell surface glycoprotein receptor antibody, anti-CD200 receptor 1 antibody, anti-Cd200r1 antibody, anti-Cell surface glycoprotein CD200 receptor 1 antibody, anti-Cell surface glycoprotein OX2 receptor 1 antibody, anti-Cell surface glycoprotein OX2 receptor antibody, anti-cell surface glycoprotein receptor CD200 antibody, anti-CRTR 2 antibody, anti-CRTR2 antibody, anti-HCRTR2 antibody, anti-MO2R1_HUMAN antibody, anti-MOX2 receptor antibody, anti-MOX2R antibody, anti-OX2R antibody3870KLH conjugated synthetic peptide derived from human CD200Rorb159257100 ulCd200R antibodyanti CD 200R antibody, anti CD200 cell surface glycoprotein receptor antibody, anti CD200 receptor 1 antibody, anti Cd200r1 antibody, anti Cell surface glycoprotein CD200 receptor 1 antibody, anti Cell surface glycoprotein OX2 receptor 1 antibody, anti Cell surface glycoprotein OX2 receptor antibody, anti cell surface glycoprotein receptor CD200 antibody, anti CRTR 2 antibody, anti CRTR2 antibody, anti HCRTR2 antibody, anti MO2R1_HUMAN antibody, anti MOX2 receptor antibody, anti MOX2R antibody, anti OX2R antibody3330KLH conjugated synthetic peptide derived from human CD200Rorb159257200 ulCd200R antibodyanti CD 200R antibody, anti CD200 cell surface glycoprotein receptor antibody, anti CD200 receptor 1 antibody, anti Cd200r1 antibody, anti Cell surface glycoprotein CD200 receptor 1 antibody, anti Cell surface glycoprotein OX2 receptor 1 antibody, anti Cell surface glycoprotein OX2 receptor antibody, anti cell surface glycoprotein receptor CD200 antibody, anti CRTR 2 antibody, anti CRTR2 antibody, anti HCRTR2 antibody, anti MO2R1_HUMAN antibody, anti MOX2 receptor antibody, anti MOX2R antibody, anti OX2R antibody4500KLH conjugated synthetic peptide derived from human CD200Rorb3025240.1 mgCD200r antibody (FITC)8550orb42137100 ugCD200R1 antibodyanti-CD200R1 / CD200R / OX2R antibody4680Recombinant human CD200R1 protein.orb4213750 ugCD200R1 antibodyanti-CD200R1 / CD200R / OX2R antibody3420Recombinant human CD200R1 protein.orb42137200 ugCD200R1 antibodyanti-CD200R1 / CD200R / OX2R antibody6030Recombinant human CD200R1 protein.orb42139100 ugCD200R1 antibodyanti-CD200R1 / OX2R antibody4680Recombinant mouse CD200R1 protein.orb4213950 ugCD200R1 antibodyanti-CD200R1 / OX2R antibody3420Recombinant mouse CD200R1 protein.orb42139200 ugCD200R1 antibodyanti-CD200R1 / OX2R antibody6030Recombinant mouse CD200R1 protein.orb252682100 ulCD200R1 antibody4716KLH conjugated synthetic peptideorb42136200 ugCD200R1 antibodyanti-CD200R1 / CD200R / OX2R antibody4680Recombinant human CD200R1 protein .orb42136100 ugCD200R1 antibodyanti-CD200R1 / CD200R / OX2R antibody3420Recombinant human CD200R1 protein .orb42136400 ugCD200R1 antibodyanti-CD200R1 / CD200R / OX2R antibody6030Recombinant human CD200R1 protein .orb42138200 ugCD200R1 antibodyanti-CD200R1 / OX2R antibody4680Recombinant mouse CD200R1 protein.orb42138100 ugCD200R1 antibodyanti-CD200R1 / OX2R antibody3420Recombinant mouse CD200R1 protein.orb42138400 ugCD200R1 antibodyanti-CD200R1 / OX2R antibody6030Recombinant mouse CD200R1 protein.orb230558200 ugCD200R1 antibody6030orb23055850 ugCD200R1 antibody3420orb230558100 ugCD200R1 antibody4680orb361867200 ugCD200R1 antibody6030Recombinant human CD200R1 Protein orb36186750 ugCD200R1 antibody3420Recombinant human CD200R1 Protein orb361867100 ugCD200R1 antibody4680Recombinant human CD200R1 Protein orb215366200 ulCD200R1 antibodyanti CD200R antibody, anti CRTR2 antibody, anti MOX2R antibody, anti OX2R antibody, anti Cell surface glycoprotein CD200 receptor 1 antibody, anti CD200 cell surface glycoprotein receptor antibody, anti Cell surface glycoprotein OX2 receptor 1 antibody4410orb215366100 ulCD200R1 antibodyanti CD200R antibody, anti CRTR2 antibody, anti MOX2R antibody, anti OX2R antibody, anti Cell surface glycoprotein CD200 receptor 1 antibody, anti CD200 cell surface glycoprotein receptor antibody, anti Cell surface glycoprotein OX2 receptor 1 antibody2970orb374028200 ulCD200R1 antibody6480Recombinant protein of human CD200R1orb37402850 ulCD200R1 antibody3060Recombinant protein of human CD200R1orb374028100 ulCD200R1 antibody4140Recombinant protein of human CD200R1orb375504250 ugCD200R1 antibody6660Cellsorb163765400 ulCD200R1 antibodyAnti CD200R1 antibody, anti CD200R antibody, anti CRTR2 antibody, anti MOX2R antibody, anti OX2R antibody, anti Cell surface glycoprotein CD200 receptor 1 antibody, anti CD200 cell surface glycoprotein receptor antibody, anti Cell surface glycoprotein OX2 receptor 1 antibody4050This CD200R1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 275-303 amino acids from the C-terminal region of human CD200R1.orb17094950 ugCD200R1 antibody4050Recombinant Mouse CD200R1 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD200R1orb170949100 ugCD200R1 antibody6030Recombinant Mouse CD200R1 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD200R1orb36128350 ugCD200R1 antibody4050Recombinant human CD200R1 Protein orb361283100 ugCD200R1 antibody6030Recombinant human CD200R1 Protein orb36233250 ugCD200R1 antibody4050Recombinant mouse CD200R1 Protein orb362332100 ugCD200R1 antibody6030Recombinant mouse CD200R1 Protein orb35259550 ulCD200R1 antibodyanti-CD200 cell surface glycoprotein receptor antibody, anti-Cell surface glycoprotein OX2 receptor 1 antibody, anti-CD200R1 antibody, anti-CD200R antibody, anti-CRTR2 antibody, anti-MOX2R antibody, anti-OX2R antibody2520Recombinant human Cell surface glycoprotein CD200 receptor 1 protein (226-325aa)orb352595100 ulCD200R1 antibodyanti-CD200 cell surface glycoprotein receptor antibody, anti-Cell surface glycoprotein OX2 receptor 1 antibody, anti-CD200R1 antibody, anti-CD200R antibody, anti-CRTR2 antibody, anti-MOX2R antibody, anti-OX2R antibody3420Recombinant human Cell surface glycoprotein CD200 receptor 1 protein (226-325aa)orb35329150 ulCD200R1 antibodyanti-CD200 cell surface glycoprotein receptor antibody, anti-Cell surface glycoprotein OX2 receptor 1 antibody, anti-CD200R1 antibody, anti-CD200R antibody, anti-CRTR2 antibody, anti-MOX2R antibody, anti-OX2R antibody2520Recombinant human Cell surface glycoprotein CD200 receptor 1 protein (226-325aa)orb353291100 ulCD200R1 antibodyanti-CD200 cell surface glycoprotein receptor antibody, anti-Cell surface glycoprotein OX2 receptor 1 antibody, anti-CD200R1 antibody, anti-CD200R antibody, anti-CRTR2 antibody, anti-MOX2R antibody, anti-OX2R antibody3420Recombinant human Cell surface glycoprotein CD200 receptor 1 protein (226-325aa)orb36130650 TestCD200R1 antibody (APC)4050Recombinant human CD200R1 Protein orb361306100 TestCD200R1 antibody (APC)6030Recombinant human CD200R1 Protein orb36111350 TestCD200R1 antibody (PE)4050Recombinant human CD200R1 Protein orb361113100 TestCD200R1 antibody (PE)6030Recombinant human CD200R1 Protein orb36124850 TestCD200R1 antibody (PE)4050Recombinant mouse CD200R1 Protein orb361248100 TestCD200R1 antibody (PE)6030Recombinant mouse CD200R1 Protein orb166049400 ulCD200R1L antibodyAnti CD200R1L antibody, anti CD200R2 antibody, anti Cell surface glycoprotein CD200 receptor 2 antibody, anti CD200 cell surface glycoprotein receptor-like 2 antibody, anti CD200 cell surface glycoprotein receptor-like a antibody, anti Cell surface glycoprotein CD200 receptor 1-like antibody, anti Cell surface glycoprotein OX2 receptor 2 antibody4050KLH conjugated synthetic peptide between 63-92 amino acids from the N-terminal region of human CD200R1L.orb42142100 ugCD200R4 antibodyanti-CD200R4 / CD200 Receptor 4 antibody6030Recombinant mouse CD200R4 protein.orb4214250 ugCD200R4 antibodyanti-CD200R4 / CD200 Receptor 4 antibody4050Recombinant mouse CD200R4 protein.orb42141100 ugCD200R4 antibodyanti-CD200R4 / CD200RLa antibody4680Recombinant mouse CD200R4 protein.orb4214150 ugCD200R4 antibodyanti-CD200R4 / CD200RLa antibody3420Recombinant mouse CD200R4 protein.orb42141200 ugCD200R4 antibodyanti-CD200R4 / CD200RLa antibody6030Recombinant mouse CD200R4 protein.orb42140200 ugCD200R4 antibodyanti-CD200R4 / CD200RLa antibody4680Recombinant mouse CD200R4 protein.orb42140100 ugCD200R4 antibodyanti-CD200R4 / CD200RLa antibody3420Recombinant mouse CD200R4 protein.orb42140400 ugCD200R4 antibodyanti-CD200R4 / CD200RLa antibody6030Recombinant mouse CD200R4 protein.orb23157550 ugCD200R4 antibody4050orb231575100 ugCD200R4 antibody6030orb42145100 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody6030Recombinant cynomolgus CD200RLa protein.orb4214550 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody4050Recombinant cynomolgus CD200RLa protein.orb42146100 ugCD200RLa antibodyanti-CD200R1L / CD200R2 / CD200RLa antibody6030Recombinant human CD200R1L protein .orb4214650 ugCD200RLa antibodyanti-CD200R1L / CD200R2 / CD200RLa antibody4050Recombinant human CD200R1L protein .orb42144100 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody4680Recombinant cynomolgus CD200RLa protein.orb4214450 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody3420Recombinant cynomolgus CD200RLa protein.orb42144200 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody6030Recombinant cynomolgus CD200RLa protein.orb42143200 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody4680Recombinant cynomolgus CD200RLa protein.orb42143100 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody3420Recombinant cynomolgus CD200RLa protein.orb42143400 ugCD200RLa antibodyanti-Cynomolgus CD200RLa antibody6030Recombinant cynomolgus CD200RLa protein.orb170528200 ugCD200RLa antibodyanti CD200R1L antibody6030Recombinant Human CD200RLa/CD200R1L protein. Produced in rabbits immunized with purified, recombinant Human CD200RLa/CD200R1Lorb17052850 ugCD200RLa antibodyanti CD200R1L antibody3420Recombinant Human CD200RLa/CD200R1L protein. Produced in rabbits immunized with purified, recombinant Human CD200RLa/CD200R1Lorb170528100 ugCD200RLa antibodyanti CD200R1L antibody4680Recombinant Human CD200RLa/CD200R1L protein. Produced in rabbits immunized with purified, recombinant Human CD200RLa/CD200R1Lorb170688200 ugCD200RLa antibodyanti CD200R1L antibody6030Recombinant Human CD200RLa/CD200R1L protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD200RLa/CD200R1Lorb17068850 ugCD200RLa antibodyanti CD200R1L antibody3420Recombinant Human CD200RLa/CD200R1L protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD200RLa/CD200R1Lorb170688100 ugCD200RLa antibodyanti CD200R1L antibody4680Recombinant Human CD200RLa/CD200R1L protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD200RLa/CD200R1Lorb230652200 ugCD200RLa antibody6030orb23065250 ugCD200RLa antibody3420orb230652100 ugCD200RLa antibody4680orb361874200 ugCD200RLa antibody6030Recombinant monkey CD200RLa/CD200R1L protein orb36187450 ugCD200RLa antibody3420Recombinant monkey CD200RLa/CD200R1L protein orb361874100 ugCD200RLa antibody4680Recombinant monkey CD200RLa/CD200R1L protein orb170527400 ugCD200RLa antibodyanti CD200R1L antibody6030Recombinant Human CD200RLa/CD200R1L protein. Produced in rabbits immunized with purified, recombinant Human CD200RLa/CD200R1Lorb170527100 ugCD200RLa antibodyanti CD200R1L antibody3420Recombinant Human CD200RLa/CD200R1L protein. Produced in rabbits immunized with purified, recombinant Human CD200RLa/CD200R1Lorb170527200 ugCD200RLa antibodyanti CD200R1L antibody4680Recombinant Human CD200RLa/CD200R1L protein. Produced in rabbits immunized with purified, recombinant Human CD200RLa/CD200R1Lorb311234100 ulCD201 antibody4716KLH Conjugated synthetic peptideorb315669200 ulCD201 antibodyanti EPCR antibody, anti Endothelial protein C receptor antibody, anti Activated protein C receptor antibody, anti APC receptor antibody, anti Endothelial cell protein C receptor antibody, anti CD201 antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD201. The exact sequence is proprietary.orb315669100 ulCD201 antibodyanti EPCR antibody, anti Endothelial protein C receptor antibody, anti Activated protein C receptor antibody, anti APC receptor antibody, anti Endothelial cell protein C receptor antibody, anti CD201 antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD201. The exact sequence is proprietary.orb170763400 ugCD201 antibodyanti Epcr antibody, anti PROCR antibody6030Recombinant Mouse Epcr/PROCR protein. Produced in rabbits immunized with purified, recombinant Mouse Epcr/PROCRorb170763100 ugCD201 antibodyanti Epcr antibody, anti PROCR antibody3420Recombinant Mouse Epcr/PROCR protein. Produced in rabbits immunized with purified, recombinant Mouse Epcr/PROCRorb170763200 ugCD201 antibodyanti Epcr antibody, anti PROCR antibody4680Recombinant Mouse Epcr/PROCR protein. Produced in rabbits immunized with purified, recombinant Mouse Epcr/PROCRorb34277400 ulCD201 antibodyAnti-Endothelial protein C receptor antibody, anti-Endothelial cell protein C receptor antibody, anti-Activated protein C receptor antibody, anti-APC receptor antibody, anti-CD201 antibody, anti-EPCR antibody, anti-PROCR antibody4050This CD201 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 104-132 amino acids from the Central region of human CD201.orb308521200 ugCD202b antibodyanti CD202b antibody, anti Tie-2 antibody3780Eahy 926 cell lineorb308522200 TestsCD202b antibodyanti CD202b antibody, anti Tie-2 antibody3780Eahy 926 cell lineorb447430.1 mgCD203c antibodyAnti-CD203c antibody4410orb337314100 ulCD203c antibody3798A synthesized peptide derived from human CD203corb33731450 ulCD203c antibody3258A synthesized peptide derived from human CD203corb315776200 ulCD203c antibodyanti PDNP3 antibody, anti Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 antibody, anti E-NPP 3 antibody, anti Phosphodiesterase I beta antibody, anti PD-Ibeta antibody, anti Phosphodiesterase I/nucleotide pyrophosphatase 3 antibody, anti CD203c antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD203c. The exact sequence is proprietary.orb315776100 ulCD203c antibodyanti PDNP3 antibody, anti Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 antibody, anti E-NPP 3 antibody, anti Phosphodiesterase I beta antibody, anti PD-Ibeta antibody, anti Phosphodiesterase I/nucleotide pyrophosphatase 3 antibody, anti CD203c antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD203c. The exact sequence is proprietary.orb8804850 ugCD203c antibodyanti ENPP3 antibody, anti CD203c antigen antibody, anti CD203c antibody, anti E-NPP 3 antibody, anti NPP3 antibody, anti Phosphodiesterase-I beta antibody, anti PD-IBETA antibody, anti PDNP3 antibody, anti Phosphodiesterase I beta antibody, anti B10 antibody, anti gp130RB13-6 antibody6660Synthetic peptideorb8804950 ugCD203c antibodyanti ENPP3 antibody, anti CD203c antigen antibody, anti CD203c antibody, anti E-NPP 3 antibody, anti NPP3 antibody, anti Phosphodiesterase-I beta antibody, anti PD-IBETA antibody, anti PDNP3 antibody, anti Phosphodiesterase I beta antibody, anti B10 antibody, anti gp130RB13-6 antibody6660Synthetic peptideorb9482450 ugCD203c antibodyanti ENPP3 antibody, anti CD203c antigen antibody, anti CD203c antibody, anti E-NPP 3 antibody, anti NPP3 antibody, anti Phosphodiesterase-I beta antibody, anti PD-IBETA antibody, anti PDNP3 antibody, anti Phosphodiesterase I beta antibody, anti B10 antibody, anti gp130RB13-6 antibody6660Synthetic peptideorb9482350 ugCD203c antibodyanti ENPP3 antibody, anti CD203c antigen antibody, anti CD203c antibody, anti E-NPP 3 antibody, anti NPP3 antibody, anti Phosphodiesterase-I beta antibody, anti PD-IBETA antibody, anti PDNP3 antibody, anti Phosphodiesterase I beta antibody, anti B10 antibody, anti gp130RB13-6 antibody6660Synthetic peptideorb154435100 TestsCD203c antibody (APC)5670"HEK-293 cells transfected with human CD203c"orb15186100 ugCD203c antibody (FITC)anti-Alkaline phosphodiesterase I antibody, anti-B10 antibody, anti-CD203c antibody, anti-CD203cgen antibody, anti-dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) antibody, anti-dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) antibody, anti-E NPP 3bod antibody3870Synthetic peptide (please contact us for details)orb154473100 TestsCD203c antibody (FITC)4770"HEK-293 cells transfected with human CD203c"orb44744100 testsCD203c antibody (PE)Anti-CD203c antibody5670orb447230.1 mgCD205 antibodyAnti-CD205 antibody3960orb3024120.2 mgCD205 antibody11700orb3024130.1 mgCD205 antibody (FITC)9090orb154513100 TestsCD205 antibody (PE )5670Recombinant Fc-tagged human CD205orb302414100 TestsCD205 antibody (PE)11250orb3023890.2 mgCD206 antibodyanti C type lectin domain family 13 member D antibody, anti C-type lectin domain family 13 member D antibody, anti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody10710orb160315100 ugCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody2970Synthesized peptide derived from the Internal region of human CD206.orb308745100 ugCD206 antibodyanti MMR antibody3690Human mannose receptororb308746100 ugCD206 antibody3690Human mannose receptororb4941100 ugCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody,anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody3330orb4941200 ugCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody,anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody4500orb180464100 ugCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody,anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody3330orb180464200 ugCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody,anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody4500orb128383100 ugCD206 antibodyanti C type lectin domain family 13 member D antibody, anti C-type lectin domain family 13 member D antibody, anti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody,anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody2880Internalorb128383200 ugCD206 antibodyanti C type lectin domain family 13 member D antibody, anti C-type lectin domain family 13 member D antibody, anti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody,anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody4140Internalorb194675100 ulCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody4716Synthesized peptide derived from internal of human MRC1.orb311545100 ulCD206 antibody4716KLH Conjugated synthetic peptideorb226677100 ulCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody3798A synthesized peptideorb22667720 ulCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody2736A synthesized peptideorb22667750 ulCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody3258A synthesized peptideorb314071200 ulCD206 antibodyanti CD206 antibody, anti BA541I19.1 antibody, anti CLEC13D antibody, anti CD206 antibody, anti CD206 antigen antibody, anti Macrophage mannose receptor 1 antibody, anti Mannose Receptor antibody, anti Macrophage mannose receptor antibody, anti MMR antibody, anti Mannose receptor antibody, anti C type 1 antibody, anti CD206L1 antibody, anti CLEC13DL antibody6660Synthetic peptideorb214272200 ulCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody4410orb214272100 ulCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody2970orb9471050 ugCD206 antibodyanti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody7470orb35793350 ugCD206 antibodyanti C type lectin domain family 13 member D antibody, anti C-type lectin domain family 13 member D antibody, anti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody3420Recombinant human Macrophage mannose receptor 1 proteinorb357933100 ugCD206 antibodyanti C type lectin domain family 13 member D antibody, anti C-type lectin domain family 13 member D antibody, anti CD 206 antibody, anti CD206 antibody, anti CD206 antigen antibody, anti CLEC13D antibody, anti CLEC13DL antibody, anti Macrophage mannose receptor 1 antibody, anti Macrophage mannose receptor 1 like protein 1 antibody, anti Macrophage mannose receptor antibody, anti Mannose receptor C type 1 antibody, anti Mannose receptor C type 1 like 1 antibody, anti MMR antibody, anti MRC 1 antibody, anti MRC1 antibody, anti MRC1L1 antibody5130Recombinant human Macrophage mannose receptor 1 proteinorb35793450 ugCD206 antibody (Biotin)anti-Macrophage mannose receptor 1 antibody, anti-MMR antibody, anti-CD206 antibody, anti-CLEC13D antibody, anti-CLEC13DL antibody, anti-CD206L1 antibody, anti-C-type lectin domain family 13 member D antibody, anti-C-type lectin domain family 13 member D-like antibody, anti-Human mannose receptor antibody, anti-hMR antibody, anti-Macrophage mannose receptor 1-like protein 1 antibody, anti-CD_antigen: CD206 antibody3420Recombinant human Macrophage mannose receptor 1 proteinorb357934100 ugCD206 antibody (Biotin)anti-Macrophage mannose receptor 1 antibody, anti-MMR antibody, anti-CD206 antibody, anti-CLEC13D antibody, anti-CLEC13DL antibody, anti-CD206L1 antibody, anti-C-type lectin domain family 13 member D antibody, anti-C-type lectin domain family 13 member D-like antibody, anti-Human mannose receptor antibody, anti-hMR antibody, anti-Macrophage mannose receptor 1-like protein 1 antibody, anti-CD_antigen: CD206 antibody5130Recombinant human Macrophage mannose receptor 1 proteinorb7789100 ugCD206 antibody (FITC)anti CD 206 antibody (FITC), anti CD206 antibody (FITC), anti CD206 antigen antibody (FITC), anti CLEC13D antibody (FITC), anti CLEC13DL antibody (FITC), anti Macrophage mannose receptor 1 antibody (FITC), anti Macrophage mannose receptor 1 like protein 1 antibody (FITC), anti Macrophage mannose receptor antibody (FITC), anti Mannose receptor C type 1 antibody (FITC), anti Mannose receptor C type 1 like 1 antibody (FITC), anti MMR antibody (FITC), anti MRC 1 antibody (FITC), anti MRC1 antibody (FITC), anti MRC1L1 antibody (FITC)3330KLH conjugated synthetic peptide derived from human CLEC13D. Please contact us for the exact immunogen sequence.orb35793550 ugCD206 antibody (FITC)anti-Macrophage mannose receptor 1 antibody, anti-MMR antibody, anti-CD206 antibody, anti-CLEC13D antibody, anti-CLEC13DL antibody, anti-CD206L1 antibody, anti-C-type lectin domain family 13 member D antibody, anti-C-type lectin domain family 13 member D-like antibody, anti-Human mannose receptor antibody, anti-hMR antibody, anti-Macrophage mannose receptor 1-like protein 1 antibody, anti-CD_antigen: CD206 antibody3420Recombinant human Macrophage mannose receptor 1 proteinorb357935100 ugCD206 antibody (FITC)anti-Macrophage mannose receptor 1 antibody, anti-MMR antibody, anti-CD206 antibody, anti-CLEC13D antibody, anti-CLEC13DL antibody, anti-CD206L1 antibody, anti-C-type lectin domain family 13 member D antibody, anti-C-type lectin domain family 13 member D-like antibody, anti-Human mannose receptor antibody, anti-hMR antibody, anti-Macrophage mannose receptor 1-like protein 1 antibody, anti-CD_antigen: CD206 antibody5130Recombinant human Macrophage mannose receptor 1 proteinorb35793650 ugCD206 antibody (HRP)anti-Macrophage mannose receptor 1 antibody, anti-MMR antibody, anti-CD206 antibody, anti-CLEC13D antibody, anti-CLEC13DL antibody, anti-CD206L1 antibody, anti-C-type lectin domain family 13 member D antibody, anti-C-type lectin domain family 13 member D-like antibody, anti-Human mannose receptor antibody, anti-hMR antibody, anti-Macrophage mannose receptor 1-like protein 1 antibody, anti-CD_antigen: CD206 antibody3420Recombinant human Macrophage mannose receptor 1 proteinorb357936100 ugCD206 antibody (HRP)anti-Macrophage mannose receptor 1 antibody, anti-MMR antibody, anti-CD206 antibody, anti-CLEC13D antibody, anti-CLEC13DL antibody, anti-CD206L1 antibody, anti-C-type lectin domain family 13 member D antibody, anti-C-type lectin domain family 13 member D-like antibody, anti-Human mannose receptor antibody, anti-hMR antibody, anti-Macrophage mannose receptor 1-like protein 1 antibody, anti-CD_antigen: CD206 antibody5130Recombinant human Macrophage mannose receptor 1 proteinorb308747100 TestsCD206 antibody (PE)5670Human mannose receptororb252153100 ulCD207 antibody4716KLH conjugated synthetic peptideorb255287100 ulCD207 antibody4716KLH conjugated synthetic peptideorb311222100 ulCD207 antibody4716KLH Conjugated synthetic peptideorb229923200 ugcd207 antibody6030orb22992350 ugcd207 antibody3420orb229923100 ugcd207 antibody4680orb361545200 ugcd207 antibody6030A synthetic peptide corresponding to the N-terminus of the human cd207orb36154550 ugcd207 antibody3420A synthetic peptide corresponding to the N-terminus of the human cd207orb361545100 ugcd207 antibody4680A synthetic peptide corresponding to the N-terminus of the human cd207orb247492200 ulCD207 antibodyanti CLEC4K antibody6480Recombinant protein of human CD207orb24749250 ulCD207 antibodyanti CLEC4K antibody3060Recombinant protein of human CD207orb247492100 ulCD207 antibodyanti CLEC4K antibody4140Recombinant protein of human CD207orb5364350 ugCd207 antibody3420Recombinant Mouse C-type lectin domain family 4 member K proteinorb53643100 ugCd207 antibody5130Recombinant Mouse C-type lectin domain family 4 member K proteinorb5364650 ugCd207 antibody (Biotin)3420Recombinant Mouse C-type lectin domain family 4 member K proteinorb53646100 ugCd207 antibody (Biotin)5130Recombinant Mouse C-type lectin domain family 4 member K proteinorb5364550 ugCd207 antibody (FITC)3420Recombinant Mouse C-type lectin domain family 4 member K proteinorb53645100 ugCd207 antibody (FITC)5130Recombinant Mouse C-type lectin domain family 4 member K proteinorb5364450 ugCd207 antibody (HRP)3420Recombinant Mouse C-type lectin domain family 4 member K proteinorb53644100 ugCd207 antibody (HRP)5130Recombinant Mouse C-type lectin domain family 4 member K proteinorb42149100 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody6030Recombinant human LAMP3 protein.orb4214950 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody4050Recombinant human LAMP3 protein.orb42148100 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody4680Recombinant human CD208 protein.orb4214850 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody3420Recombinant human CD208 protein.orb42148200 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody6030Recombinant human CD208 protein.orb42150100 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody4680Recombinant human LAMP3 protein.orb4215050 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody3420Recombinant human LAMP3 protein.orb42150200 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody6030Recombinant human LAMP3 protein.orb42147200 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody4680Recombinant human LAMP3 protein.orb42147100 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody3420Recombinant human LAMP3 protein.orb42147400 ugCD208 antibodyanti-DC-LAMP antibody, anti-LAMP3 antibody, anti-CD208 / LAMP3 / DC-LAMP antibody6030Recombinant human LAMP3 protein.orb230238200 ugCD208 antibody6030orb23023850 ugCD208 antibody3420orb230238100 ugCD208 antibody4680orb23023750 ugCD208 antibody4050orb230237100 ugCD208 antibody6030orb1543810.1 mgCD209 antibody3690CD209-His-tagged fusion proteinorb318734100 ugCD209 antibodyanti CD209 antibody, anti CD209 molecule antibody, anti CDSIGN antibody, anti CLEC4L antibody, anti DC-SIGN antibody, anti DC-SIGN1 antibody, anti C-type lectin domain family 4 member L antibody, anti C-type lectin domain family 4, member L antibody, anti CD209 antigen antibody, anti HIV gpl20-binding protein antibody, anti dendritic cell-specific ICAM-3-grabbing non-integrin 1 antibody, anti dendritic cell-spe antibody4500Internal region C-NRGEPNNVGEEDorb385501100 ugCD209 antibody7200orb388207100 ugCD209 antibody4356Recombinant human CD209 protein fragmentorb69575100 ulCD209 antibodyanti CD209 antibody3438orb311538100 ulCD209 antibody4716KLH Conjugated synthetic peptideorb335125100 ulCD209 antibody3798A synthesized peptideorb33512550 ulCD209 antibody3258A synthesized peptideorb337234100 ulCD209 antibody3798A synthesized peptide derived from human CD209orb33723450 ulCD209 antibody3258A synthesized peptide derived from human CD209orb5637920 ugCD209 antibody3960A human partial recombinant protein was used as the immunogen for the DC-SIGN antibody.orb56379100 ugCD209 antibody5850A human partial recombinant protein was used as the immunogen for the DC-SIGN antibody.orb362804200 ugCD209 antibody6030Recombinant human CD209/DC-SIGN Protein orb36280450 ugCD209 antibody3420Recombinant human CD209/DC-SIGN Protein orb362804100 ugCD209 antibody4680Recombinant human CD209/DC-SIGN Protein orb136879200 ulCD209 antibodyanti CD209 antibody6480Recombinant protein of human CD209orb136879100 ulCD209 antibodyanti CD209 antibody4140Recombinant protein of human CD209orb13687950 ulCD209 antibodyanti CD209 antibody3060Recombinant protein of human CD209orb339142200 ulCD209 antibodyanti CLEC4L antibody, anti CD209 antigen antibody, anti C-type lectin domain family 4 member L antibody, anti Dendritic cell-specific ICAM-3-grabbing non-integrin 1 antibody, anti DC-SIGN antibody, anti DC-SIGN1 antibody, anti CD209 antibody4320orb339142100 ulCD209 antibodyanti CLEC4L antibody, anti CD209 antigen antibody, anti C-type lectin domain family 4 member L antibody, anti Dendritic cell-specific ICAM-3-grabbing non-integrin 1 antibody, anti DC-SIGN antibody, anti DC-SIGN1 antibody, anti CD209 antibody3870orb40157400 ulCD209 antibodyAnti-CD_antigen=CD209 antibody, anti-C-type lectin domain family 4 member L antibody, anti-Dendritic cell-specific ICAM-3-grabbing non-integrin 1 antibody, anti-DC-SIGN1 antibody, anti-DC-SIGN antibody, anti-CD209 antigen antibody, anti-CLEC4L antibody, anti-CD209 antibody4050This CD209 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 330-355 amino acids from the Central region of human CD209.orb8671450 ugCD209 antibodyanti DCSIGN antibody6660orb5383150 ugCD209 antibody3420Recombinant Human CD209 antigen proteinorb53831100 ugCD209 antibody5130Recombinant Human CD209 antigen proteinorb154441100 TestsCD209 antibody (APC)5670CD209-His-tagged fusion proteinorb5383450 ugCD209 antibody (Biotin)3420Recombinant Human CD209 antigen proteinorb53834100 ugCD209 antibody (Biotin)5130Recombinant Human CD209 antigen proteinorb5383350 ugCD209 antibody (FITC)3420Recombinant Human CD209 antigen proteinorb53833100 ugCD209 antibody (FITC)5130Recombinant Human CD209 antigen proteinorb5383250 ugCD209 antibody (HRP)3420Recombinant Human CD209 antigen proteinorb53832100 ugCD209 antibody (HRP)5130Recombinant Human CD209 antigen proteinorb154500100 TestsCD209 antibody (PE )5670CD209-His-tagged fusion proteinorb182926100 ugCD209b antibodyanti CD209B antibody, anti CD209b antigen antibody, anti Cd209b antibody2970KLH conjugated synthetic peptide derived from human CD209borb182926200 ugCD209b antibodyanti CD209B antibody, anti CD209b antigen antibody, anti Cd209b antibody3870KLH conjugated synthetic peptide derived from human CD209borb187239100 ugCD209b antibody (FITC)anti CD209B antibody, anti CD209b antigen antibody, anti Cd209b antibody3870KLH conjugated synthetic peptide derived from human CD209borb182938100 ugCD20L1 antibody2970KLH conjugated synthetic peptide derived from human CD20L1/MS4A4Aorb182938200 ugCD20L1 antibody3870KLH conjugated synthetic peptide derived from human CD20L1/MS4A4Aorb187251100 ugCD20L1 antibody (FITC)3870KLH conjugated synthetic peptide derived from human CD20L1/MS4A4Aorb182939100 ugCD20L2 antibody2970KLH conjugated synthetic peptide derived from human CD20L2/MS4A5orb182939200 ugCD20L2 antibody3870KLH conjugated synthetic peptide derived from human CD20L2/MS4A5orb187252100 ugCD20L2 antibody (FITC)3870KLH conjugated synthetic peptide derived from human CD20L2/MS4A5orb182940100 ugCD20L4 antibody2970KLH conjugated synthetic peptide derived from human CD20L4/MS4A7orb182940200 ugCD20L4 antibody3870KLH conjugated synthetic peptide derived from human CD20L4/MS4A7orb187253100 ugCD20L4 antibody (FITC)3870KLH conjugated synthetic peptide derived from human CD20L4/MS4A7orb182941100 ugCD20L5 antibody2970KLH conjugated synthetic peptide derived from human CD20L5/MS4A8Borb182941200 ugCD20L5 antibody3870KLH conjugated synthetic peptide derived from human CD20L5/MS4A8Borb187254100 ugCD20L5 antibody (FITC)3870KLH conjugated synthetic peptide derived from human CD20L5/MS4A8Borb439440.1 mgCD21 antibodyAnti-CD21 antibody3690orb2236660.1 mlCD21 antibodyanti C3DR antibody, anti CD21 antibody, anti Complement C3d receptor antibody, anti complement component (3d/Epstein Barr virus) receptor 2 antibody, anti Complement receptor type 2 antibody, anti CR2 antibody, anti EBV receptor antibody, anti Epstein-Barr virus receptor antibody, anti SLEB9 antibody5400Myeloma cell line Roborb3018011 mlCD21 antibody3960orb3021391 mlCD21 antibody11160orb3021401 mlCD21 antibody13680orb3026351 mlCD21 antibodyanti C3d Receptor antibody6570orb3027631 mlCD21 antibody14850orb302109100 ugCD21 antibodyanti CR2 antibody10080orb7143100 ugCD21 antibodyanti-CD21 antibody, anti-C3DR antibody, anti-CD 21 antibody, anti-CD21 antigen antibody, anti-Complement C3d receptor antibody, anti-Complement component (3d/Epstein Barr virus) receptor 2 antibody, anti-Complement component receptor 2 antibody, anti-Complement receptor type 2 antibody, anti-Cr 2 antibody, anti-Cr2 antibody, anti-EBV receptor antibody, anti-Epstein Barr virus receptor.3330KLH conjugated synthetic peptide derived from human CD21 C-terminus. Please contact us for the exact immunogen sequence.orb7143200 ugCD21 antibodyanti-CD21 antibody, anti-C3DR antibody, anti-CD 21 antibody, anti-CD21 antigen antibody, anti-Complement C3d receptor antibody, anti-Complement component (3d/Epstein Barr virus) receptor 2 antibody, anti-Complement component receptor 2 antibody, anti-Complement receptor type 2 antibody, anti-Cr 2 antibody, anti-Cr2 antibody, anti-EBV receptor antibody, anti-Epstein Barr virus receptor.4500KLH conjugated synthetic peptide derived from human CD21 C-terminus. Please contact us for the exact immunogen sequence.orb12002100 ugCD21 antibodyanti-CD21 antibody2700orb12002500 ugCD21 antibodyanti-CD21 antibody5040orb254356100 ulCD21 antibody4716KLH conjugated synthetic peptideorb311489100 ulCD21 antibody4716KLH Conjugated synthetic peptideorb94433125 ulCD21 antibody6660orb308379200 ugCD21 antibodyanti CD21 antibody3780Daudi cell lineorb308454200 ugCD21 antibodyanti CD21 antibody3780Daudi cell lineorb308458200 ugCD21 antibodyanti CD21 antibody3780Daudi cell lineorb362826200 ugCD21 antibody6030Recombinant human CD21 Protein orb36282650 ugCD21 antibody3420Recombinant human CD21 Protein orb362826100 ugCD21 antibody4680Recombinant human CD21 Protein orb248899200 ulCD21 antibodyanti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody5220orb24889950 ulCD21 antibodyanti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody3150orb248899100 ulCD21 antibodyanti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody3600orb308457200 TestsCD21 antibodyanti CD21 antibody3780Daudi cell lineorb9579450 ugCD21 antibody6660orb36282750 ugCD21 antibody4050Recombinant human CD21 Protein orb362827100 ugCD21 antibody6030Recombinant human CD21 Protein orb22654500 ugCD21 antibodyComplement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB93996Purified human B-Cells.orb226541 mgCD21 antibodyComplement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB96840Purified human B-Cells.orb181438500 ulCD21 antibody7200Peptide derived from C-terminal region of human CD21orb1814381 mlCD21 antibody11394Peptide derived from C-terminal region of human CD21orb181438100 ulCD21 antibody5238Peptide derived from C-terminal region of human CD21orb181438200 ulCD21 antibody5616Peptide derived from C-terminal region of human CD21orb22655500 ugCD21 antibody (Biotin)Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB95940Purified human B-Cells.orb226551 mgCD21 antibody (Biotin)Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB97020Purified human B-Cells.orb9991100 ugCD21 antibody (FITC)anti-CD21 antibody, anti-C3DR antibody, anti-CD 21 antibody, anti-CD21 antigen antibody, anti-Complement C3d receptor antibody, anti-Complement component (3d/Epstein Barr virus) receptor 2 antibody, anti-Complement component receptor 2 antibody, anti-Complement receptor type 2 antibody, anti-Cr 2 antibody, anti-Cr2 antibody, anti-EBV receptor antibody, anti-Epstein Barr virus receptor antibody3870KLH conjugated synthetic peptide derived from human CD21 C-terminus. Please contact us for the exact immunogen sequence.orb43945100 testsCD21 antibody (FITC)Anti-CD21 antibody4770orb308455100 TestsCD21 antibody (FITC)anti CD21 antibody3780Daudi cell lineorb22366750 ulCD21 antibody (FITC)anti C3DR antibody, anti CD21 antibody, anti Complement C3d receptor antibody, anti complement component (3d/Epstein Barr virus) receptor 2 antibody, anti Complement receptor type 2 antibody, anti CR2 antibody, anti EBV receptor antibody, anti Epstein-Barr virus receptor antibody, anti SLEB9 antibody5850Myeloma cell line Roborb24874050 AssaysCD21 antibody (FITC)anti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody3600orb248740100 AssaysCD21 antibody (FITC)anti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody4770orb36250550 TestCD21 antibody (FITC)4050orb362505100 TestCD21 antibody (FITC)6030orb1200350 TestsCD21 antibody (FITC)anti-CD21 antibody (FITC)2970orb12003100 TestsCD21 antibody (FITC)anti-CD21 antibody (FITC)3870orb22656500 ugCD21 antibody (FITC)Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB95940Purified human B-Cells.orb226561 mgCD21 antibody (FITC)Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21 antigen, CR2, C3DR, CD21, SLEB97020Purified human B-Cells.orb43946100 testsCD21 antibody (PE)Anti-CD21 antibody5670orb308456100 TestsCD21 antibody (PE)anti CD21 antibody4230Daudi cell lineorb24881250 AssaysCD21 antibody (PE)anti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody4050orb248812100 AssaysCD21 antibody (PE)anti CR2 antibody, anti C3DR antibody, anti Complement receptor type 2 antibody, anti Cr2 antibody, anti Complement C3d receptor antibody, anti Epstein-Barr virus receptor antibody, anti EBV receptor antibody, anti CD antigen CD21 antibody5940orb36250650 TestCD21 antibody (PE)4050orb362506100 TestCD21 antibody (PE)6030orb1200450 TestsCD21 antibody (PE)anti-CD21 antibody (PE)2970orb12004100 TestsCD21 antibody (PE)anti-CD21 antibody (PE)4050orb3024050.1 mgCD210 antibody9090orb3024060.1 mgCD210 antibody (Biotin)9810orb302407100 TestsCD210 antibody (PE)11250orb308316200 ugCD213a1 antibodyanti CD213a1 antibody, anti IL-13Ra1 antibody3780IL-13Ra1 transfected CHO cell lineorb308317100 TestsCD213a1 antibody (Biotin)anti CD213a1 antibody, anti IL-13Ra1 antibody3780IL-13Ra1 transfected CHO cell lineorb385611100 ugCD213a2 antibody3330orb385611200 ugCD213a2 antibody4500orb308314200 ugCD213a2 antibodyanti CD213a2 antibody, anti IL-13Ra2 antibody3780IL-13Ra2 transfected CHO cell lineorb308413200 ugCD213a2 antibodyanti CD213a2 antibody, anti IL-13Ra2 antibody3780IL-13Ra2 transfected CHO cell lineorb308315100 TestsCD213a2 antibody (PE)anti CD213a2 antibody, anti IL-13Ra2 antibody4230IL-13Ra2 transfected CHO cell lineorb361556200 ugcd215 antibody6030A synthetic peptide corresponding to the center region of the human cd215orb36155650 ugcd215 antibody3420A synthetic peptide corresponding to the center region of the human cd215orb361556100 ugcd215 antibody4680A synthetic peptide corresponding to the center region of the human cd215orb256620200 ulCD218b antibodyanti IL1R7 antibody, anti Accessory protein-like antibody, anti AcPL antibody, anti CD218 antigen-like family member B antibody, anti CDw218b antibody, anti IL-1R accessory protein-like antibody, anti IL-1RAcPL antibody, anti Interleukin-1 receptor 7 antibody, anti IL-1R-7 antibody, anti IL-1R7 antibody, anti CD218b antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD218b. The exact sequence is proprietary.orb256620100 ulCD218b antibodyanti IL1R7 antibody, anti Accessory protein-like antibody, anti AcPL antibody, anti CD218 antigen-like family member B antibody, anti CDw218b antibody, anti IL-1R accessory protein-like antibody, anti IL-1RAcPL antibody, anti Interleukin-1 receptor 7 antibody, anti IL-1R-7 antibody, anti IL-1R7 antibody, anti CD218b antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD218b. The exact sequence is proprietary.orb438820.1 mgCD22 antibodyAnti-CD22 antibody, anti-BL-CAM antibody3690orb439790.1 mgCD22 antibodyAnti-CD22 antibody3690orb1376560.1 mgCD22 antibody5670orb1800440.2 mgCD22 antibody4680orb3720050.5 mlCD22 antibody8100orb3027641 mlCD22 antibody16470orb43453100 ugCD22 antibodyCD Marker3438orb137965100 ugCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody, anti BL-CAM antibody, anti CD22 antigen antibody, anti B-CELL antiGEN CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti sialic acid binding Ig-like lectin 2 antibody, anti T-cell surface antigen Leu-14 antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti SIALIC ACID-BINDING IMMUNOGLOBULIN-LIKE LECTIN 2 antibody4140A synthetic peptide corresponding to a sequence at the C-terminus of human CD22.orb316554100 ugCD22 antibodyanti B cell receptor CD22 precursor antibody, anti B lymphocyte cell adhesion molecule antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL CAM antibody, anti BL-CAM antibody, anti BLCAM antibody, anti CD 22 antibody, anti CD22 antibody, anti CD22 antigen antibody, anti CD22 molecule antibody, anti CD22 protein antibody, anti CD22_HUMAN antibody, anti Lectin 2 antibody, anti Leu14 antibody, anti Lyb8 antibody, anti MGC130020 antibody, anti sialic acid binding Ig like lectin 2 antibody, anti Sialic acid binding immunoglobulin like lectin 2 antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti SIGLEC 2 antibody, anti Siglec-2 antibody, anti SIGLEC2 antibody, anti T cell surface antigen Leu 14 antibody, anti T-cell surface antigen Leu-14 antibody4860A synthetic peptide corresponding to a sequence at the C-terminus of human CD22orb388878100 ugCD22 antibody4356Human Burkittorb388879100 ugCD22 antibody4356Human Raji cellsorb388880100 ugCD22 antibody4356Recombinant human BL-CAM/CD22 protein (aa52-178) (exact sequence is proprietary)orb389774100 ugCD22 antibody3690Whole hairy cell leukemia cells and membrane preparationorb10308100 ugCD22 antibodyanti-B cell receptor CD22 precursor antibody, anti-B lymphocyte cell adhesion molecule antibody, anti-BL-CAM antibody, anti-CD22 antibody, anti-CD22gen antibody, anti-CD22 molecule antibody, anti-CD22 protein antibody, anti-Leu-14 antibody, anti-Lyb8 antibody, anti-MGC130020 antibody, anti-SIGLEC-2 antibody2970Synthetic peptide (please contact us for details)orb10308200 ugCD22 antibodyanti-B cell receptor CD22 precursor antibody, anti-B lymphocyte cell adhesion molecule antibody, anti-BL-CAM antibody, anti-CD22 antibody, anti-CD22gen antibody, anti-CD22 molecule antibody, anti-CD22 protein antibody, anti-Leu-14 antibody, anti-Lyb8 antibody, anti-MGC130020 antibody, anti-SIGLEC-2 antibody3870Synthetic peptide (please contact us for details)orb182922100 ugCD22 antibodyanti B cell receptor CD22 precursor antibody, anti B lymphocyte cell adhesion molecule antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL CAM antibody, anti BL-CAM antibody, anti BLCAM antibody, anti CD 22 antibody, anti CD22 antibody, anti CD22 antibody, anti CD22 antigen antibody, anti CD22 molecule antibody, anti CD22 protein antibody, anti CD22_HUMAN antibody, anti Lectin 2 antibody, anti Leu14 antibody, anti Lyb8 antibody, anti MGC130020 antibody, anti sialic acid binding Ig like lectin 2 antibody, anti Sialic acid binding immunoglobulin like lectin 2 antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti SIGLEC 2 antibody, anti Siglec-2 antibody, anti SIGLEC2 antibody, anti T cell surface antigen Leu 14 antibody, anti T-cell surface antigen Leu-14 antibody2970KLH conjugated synthetic peptide derived from human CD22orb182922200 ugCD22 antibodyanti B cell receptor CD22 precursor antibody, anti B lymphocyte cell adhesion molecule antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL CAM antibody, anti BL-CAM antibody, anti BLCAM antibody, anti CD 22 antibody, anti CD22 antibody, anti CD22 antibody, anti CD22 antigen antibody, anti CD22 molecule antibody, anti CD22 protein antibody, anti CD22_HUMAN antibody, anti Lectin 2 antibody, anti Leu14 antibody, anti Lyb8 antibody, anti MGC130020 antibody, anti sialic acid binding Ig like lectin 2 antibody, anti Sialic acid binding immunoglobulin like lectin 2 antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti SIGLEC 2 antibody, anti Siglec-2 antibody, anti SIGLEC2 antibody, anti T cell surface antigen Leu 14 antibody, anti T-cell surface antigen Leu-14 antibody3870KLH conjugated synthetic peptide derived from human CD22orb12005100 ugCD22 antibodyanti-CD22 antibody2700orb12005500 ugCD22 antibodyanti-CD22 antibody5040orb12008100 ugCD22 antibodyanti-CD22 antibody2700orb12008500 ugCD22 antibodyanti-CD22 antibody5040orb153502100 ulCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody3960Purified recombinant fragment of human CD22 expressed in E. Coli.orb153503100 ulCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody3960Purified recombinant fragment of human CD22 expressed in E. Coli.orb192958100 ulCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody4716Recombinant protein of human CD22.orb386691100 ulCD22 antibody6948C-terminal region of human CD22orb336714100 ulCD22 antibody3798A synthesized peptide derived from human CD22orb33671450 ulCD22 antibody3258A synthesized peptide derived from human CD22orb43885100 testsCD22 antibodyAnti-CD22 antibody, anti-BL-CAM antibody5670orb5621920 ugCD22 antibody3960Human Burkittorb56219100 ugCD22 antibody5850Human Burkittorb5622020 ugCD22 antibody3960Human Raji cells were used as the immunogen for the CD22 antibody.orb56220100 ugCD22 antibody5850Human Raji cells were used as the immunogen for the CD22 antibody.orb5638820 ugCD22 antibody3960Amino acids 52-178 from the human protein were used as the immunogen for the CD22 antibody.orb56388100 ugCD22 antibody5850Amino acids 52-178 from the human protein were used as the immunogen for the CD22 antibody.orb170864200 ugCD22 antibody6030Recombinant Human CD22 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD22orb17086450 ugCD22 antibody3420Recombinant Human CD22 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD22orb170864100 ugCD22 antibody4680Recombinant Human CD22 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD22orb362191200 ugCD22 antibody6030Recombinant rat CD22 Protein orb36219150 ugCD22 antibody3420Recombinant rat CD22 Protein orb362191100 ugCD22 antibody4680Recombinant rat CD22 Protein orb362268200 ugCD22 antibody6030orb36226850 ugCD22 antibody3420orb362268100 ugCD22 antibody4680orb362853200 ugCD22 antibody6030orb36285350 ugCD22 antibody3420orb362853100 ugCD22 antibody4680orb377973200 ulCD22 antibody6210Recombinant full length protein of human CD22orb377973100 ulCD22 antibody4050Recombinant full length protein of human CD22orb248900200 ulCD22 antibodyanti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody5220orb24890050 ulCD22 antibodyanti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody3150orb248900100 ulCD22 antibodyanti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody3600orb248901200 ulCD22 antibodyanti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody5220orb24890150 ulCD22 antibodyanti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody3150orb248901100 ulCD22 antibodyanti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody3600orb361492400 ugCD22 antibody6030Recombinant rat CD22 Protein orb361492100 ugCD22 antibody3420Recombinant rat CD22 Protein orb361492200 ugCD22 antibody4680Recombinant rat CD22 Protein orb36104050 ugCD22 antibody4050Recombinant mouse CD22 Protein orb361040100 ugCD22 antibody6030Recombinant mouse CD22 Protein orb36104150 ugCD22 antibody4050Recombinant mouse CD22 Protein orb361041100 ugCD22 antibody6030Recombinant mouse CD22 Protein orb36107150 ugCD22 antibody4050Recombinant mouse CD22 Protein orb361071100 ugCD22 antibody6030Recombinant mouse CD22 Protein orb36131650 ugCD22 antibody4050Recombinant mouse CD22 Protein orb361316100 ugCD22 antibody6030Recombinant mouse CD22 Protein orb36234050 ugCD22 antibody4050Recombinant mouse CD22 Protein orb362340100 ugCD22 antibody6030Recombinant mouse CD22 Protein orb17901650 ulCD22 antibodyanti CD22 antibody, anti CD22 molecule antibody, anti CD22 antigen antibody, anti SIGLEC2 antibody, anti SIGLEC-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti B-cell receptor CD22 antibody, anti BL-CAM antibody6660Full length human recombinant protein of human CD22 produced in HEK293T cell.orb35359850 ulCD22 antibodyanti-B-lymphocyte cell adhesion molecule antibody, anti-BL-CAM antibody, anti-Sialic acid-binding Ig-like lectin 2 antibody, anti-Siglec-2 antibody, anti-T-cell surface antigen Leu-14 antibody, anti-CD22 antibody, anti-SIGLEC2 antibody2520Recombinant human B-cell receptor CD22 protein(708-847aa)orb353598100 ulCD22 antibodyanti-B-lymphocyte cell adhesion molecule antibody, anti-BL-CAM antibody, anti-Sialic acid-binding Ig-like lectin 2 antibody, anti-Siglec-2 antibody, anti-T-cell surface antigen Leu-14 antibody, anti-CD22 antibody, anti-SIGLEC2 antibody3420Recombinant human B-cell receptor CD22 protein(708-847aa)orb17853450 ulCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody3060Recombinant protein of human CD22orb178534100 ulCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody4140Recombinant protein of human CD22orb178534200 ulCD22 antibodyanti SIGLEC2 antibody, anti SIGLEC-2 antibody6480Recombinant protein of human CD22orb389776100 testsCD22 antibody (APC)5670Whole hairy cell leukemia cells and membrane preparationorb439800.1 mgCD22 antibody (Biotin)Anti-CD22 antibody4770orb3018080.5 mlCD22 antibody (FITC)6480orb15286100 ugCD22 antibody (FITC)anti-B cell receptor CD22 precursor antibody, anti-B lymphocyte cell adhesion molecule antibody, anti-BL-CAM antibody, anti-CD22 antibody, anti-CD22gen antibody, anti-CD22 molecule antibody, anti-CD22 protein antibody, anti-Leu-14 antibody, anti-Lyb8 antibody, anti-MGC130020 antibody, anti-SIGLEC-2 antibody3870Synthetic peptide (please contact us for details)orb187235100 ugCD22 antibody (FITC)anti B cell receptor CD22 precursor antibody, anti B lymphocyte cell adhesion molecule antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL CAM antibody, anti BL-CAM antibody, anti BLCAM antibody, anti CD 22 antibody, anti CD22 antibody, anti CD22 antibody, anti CD22 antigen antibody, anti CD22 molecule antibody, anti CD22 protein antibody, anti CD22_HUMAN antibody, anti Lectin 2 antibody, anti Leu14 antibody, anti Lyb8 antibody, anti MGC130020 antibody, anti sialic acid binding Ig like lectin 2 antibody, anti Sialic acid binding immunoglobulin like lectin 2 antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti SIGLEC 2 antibody, anti Siglec-2 antibody, anti SIGLEC2 antibody, anti T cell surface antigen Leu 14 antibody, anti T-cell surface antigen Leu-14 antibody3870KLH conjugated synthetic peptide derived from human CD22orb43883100 testsCD22 antibody (FITC)Anti-CD22 antibody, anti-BL-CAM antibody4770orb198091100 TestsCD22 antibody (FITC)4140orb1800452 ml (100 Tests)CD22 antibody (FITC)5580orb24874150 AssaysCD22 antibody (FITC)anti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody3600orb248741100 AssaysCD22 antibody (FITC)anti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody4770orb36112350 TestCD22 antibody (FITC)4050Recombinant mouse CD22 Protein orb361123100 TestCD22 antibody (FITC)6030Recombinant mouse CD22 Protein orb36250450 TestCD22 antibody (FITC)4050orb362504100 TestCD22 antibody (FITC)6030orb1200650 TestsCD22 antibody (FITC)anti-CD22 antibody (FITC)2970orb12006100 TestsCD22 antibody (FITC)anti-CD22 antibody (FITC)3870orb1200950 TestsCD22 antibody (FITC)anti-CD22 antibody (FITC)2970orb12009100 TestsCD22 antibody (FITC)anti-CD22 antibody (FITC)3870orb3018090.5 mlCD22 antibody (PE)7380orb43884100 testsCD22 antibody (PE)Anti-CD22 antibody, anti-BL-CAM antibody5670orb43982100 testsCD22 antibody (PE)Anti-CD22 antibody5670orb198143100 TestsCD22 antibody (PE)4590orb389775100 testsCD22 antibody (PE)5670Whole hairy cell leukemia cells and membrane preparationorb1800462 ml (100 Tests)CD22 antibody (PE)6120orb24881350 AssaysCD22 antibody (PE)anti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody4050orb248813100 AssaysCD22 antibody (PE)anti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody5940orb24881450 AssaysCD22 antibody (PE)anti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody4050orb248814100 AssaysCD22 antibody (PE)anti CD22 antibody, anti SIGLEC2 antibody, anti B-cell receptor CD22 antibody, anti B-lymphocyte cell adhesion molecule antibody, anti BL-CAM antibody, anti Sialic acid-binding Ig-like lectin 2 antibody, anti Siglec-2 antibody, anti T-cell surface antigen Leu-14 antibody, anti CD antigen CD22 antibody5940orb36111450 TestCD22 antibody (PE)4050Recombinant mouse CD22 Protein orb361114100 TestCD22 antibody (PE)6030Recombinant mouse CD22 Protein orb36112450 TestCD22 antibody (PE)4050Recombinant mouse CD22 Protein orb361124100 TestCD22 antibody (PE)6030Recombinant mouse CD22 Protein orb1200750 TestsCD22 antibody (PE)anti-CD22 antibody (PE)2970orb12007100 TestsCD22 antibody (PE)anti-CD22 antibody (PE)4050orb1201050 TestsCD22 antibody (PE)anti-CD22 antibody (PE)2970orb12010100 TestsCD22 antibody (PE)anti-CD22 antibody (PE)4050orb42668100 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody6390Recombinant human IGF1R protein.orb4266850 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody4410Recombinant human IGF1R protein.orb42665100 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody ( alpha subunit)4680Recombinant human IGF1R protein.orb4266550 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody ( alpha subunit)3420Recombinant human IGF1R protein.orb42665200 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody ( alpha subunit)6030Recombinant human IGF1R protein.orb42666100 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody ( beta subunit)4680Recombinant human IGF1R protein.orb4266650 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody ( beta subunit)3420Recombinant human IGF1R protein.orb42666200 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody ( beta subunit)6030Recombinant human IGF1R protein.orb42667100 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody4680Recombinant human IGF1R protein.orb4266750 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody3420Recombinant human IGF1R protein.orb42667200 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody6030Recombinant human IGF1R protein.orb42669100 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody4680Recombinant human IGF1R protein.orb4266950 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody3420Recombinant human IGF1R protein.orb42669200 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody6030Recombinant human IGF1R protein.orb42664200 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody4680Recombinant human IGF1R protein.orb42664100 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody3420Recombinant human IGF1R protein.orb42664400 ugCD221 antibodyanti IGF1R antibody, anti-CD221/IGF1R antibody6030Recombinant human IGF1R protein.orb179189100 TestsCD221 antibody (PE)anti IGF1R antibody6030Recombinant Human IGF1R / CD221 proteinorb17918950 TestsCD221 antibody (PE)anti IGF1R antibody4050Recombinant Human IGF1R / CD221 proteinorb441970.1 mgCD222 antibodyAnti-CD222 antibody, anti-IGF2 receptor antibody, anti-CIMPR antibody4140orb301985100 ugCD222 antibody6210orb385612100 ugCD222 antibody2970orb385612200 ugCD222 antibody3870orb44200100 testsCD222 antibodyAnti-CD222 antibody, anti-IGF2 receptor antibody, anti-CIMPR antibody5670orb44198100 testsCD222 antibody (FITC)Anti-CD222 antibody, anti-IGF2 receptor antibody, anti-CIMPR antibody4770orb44199100 testsCD222 antibody (PE)Anti-CD222 antibody, anti-IGF2 receptor antibody, anti-CIMPR antibody5670orb171431400 ugCD224 antibodyanti GGT1 antibody6030Recombinant Rat GGT1 protein. Produced in rabbits immunized with purified, recombinant Rat GGT1orb171431100 ugCD224 antibodyanti GGT1 antibody3420Recombinant Rat GGT1 protein. Produced in rabbits immunized with purified, recombinant Rat GGT1orb171431200 ugCD224 antibodyanti GGT1 antibody4680Recombinant Rat GGT1 protein. Produced in rabbits immunized with purified, recombinant Rat GGT1orb234796200 ulCD224 HC antibodyanti GGT antibody, anti Gamma-glutamyltranspeptidase 1 antibody, anti GGT 1 antibody, anti Gamma-glutamyltransferase 1 antibody, anti Glutathione hydrolase 1 antibody, anti Leukotriene-C4 hydrolase antibody, anti CD224 antibody4410orb234796100 ulCD224 HC antibodyanti GGT antibody, anti Gamma-glutamyltranspeptidase 1 antibody, anti GGT 1 antibody, anti Gamma-glutamyltransferase 1 antibody, anti Glutathione hydrolase 1 antibody, anti Leukotriene-C4 hydrolase antibody, anti CD224 antibody2970orb234797200 ulCD224 LC antibodyanti GGT antibody, anti Gamma-glutamyltranspeptidase 1 antibody, anti GGT 1 antibody, anti Gamma-glutamyltransferase 1 antibody, anti Glutathione hydrolase 1 antibody, anti Leukotriene-C4 hydrolase antibody, anti CD224 antibody4410orb234797100 ulCD224 LC antibodyanti GGT antibody, anti Gamma-glutamyltranspeptidase 1 antibody, anti GGT 1 antibody, anti Gamma-glutamyltransferase 1 antibody, anti Glutathione hydrolase 1 antibody, anti Leukotriene-C4 hydrolase antibody, anti CD224 antibody2970orb311390100 ulCD225 antibody4716KLH Conjugated synthetic peptideorb229924200 ugCD225 antibody6030orb22992450 ugCD225 antibody3420orb229924100 ugCD225 antibody4680orb9453050 ugCD225 antibodyanti IFITM1 antibody6660orb9472150 ugCD225 antibodyanti IFITM1 antibody6660orb3024080.1 mgCD226 antibody9090orb253507100 ulCD226 antibody4716KLH conjugated synthetic peptideorb229601100 ulCD226 antibodyanti adhesion glycoprotein antibody, anti CD226 antibody, anti CD226 antigen antibody, anti CD226 molecule antibody, anti DNAM-1 antibody, anti DNAM1 antibody, anti DNAX accessory molecule 1 antibody, anti DNAX accessory molecule-1 antibody, anti platelet and T cell activation antigen 1 antibody, anti PTA1 antibody, anti T lineage-specific activation antigen 1 antigen antibody, anti TLiSA1 antibody, anti DNAM-1 antibody3798A synthesized peptide derived from human CD226orb22960120 ulCD226 antibodyanti adhesion glycoprotein antibody, anti CD226 antibody, anti CD226 antigen antibody, anti CD226 molecule antibody, anti DNAM-1 antibody, anti DNAM1 antibody, anti DNAX accessory molecule 1 antibody, anti DNAX accessory molecule-1 antibody, anti platelet and T cell activation antigen 1 antibody, anti PTA1 antibody, anti T lineage-specific activation antigen 1 antigen antibody, anti TLiSA1 antibody, anti DNAM-1 antibody2736A synthesized peptide derived from human CD226orb22960150 ulCD226 antibodyanti adhesion glycoprotein antibody, anti CD226 antibody, anti CD226 antigen antibody, anti CD226 molecule antibody, anti DNAM-1 antibody, anti DNAM1 antibody, anti DNAX accessory molecule 1 antibody, anti DNAX accessory molecule-1 antibody, anti platelet and T cell activation antigen 1 antibody, anti PTA1 antibody, anti T lineage-specific activation antigen 1 antigen antibody, anti TLiSA1 antibody, anti DNAM-1 antibody3258A synthesized peptide derived from human CD226orb362169200 ugCD226 antibody6030Recombinant rat CD226/DNAM-1 Protein orb36216950 ugCD226 antibody3420Recombinant rat CD226/DNAM-1 Protein orb362169100 ugCD226 antibody4680Recombinant rat CD226/DNAM-1 Protein orb338982200 ulCD226 antibodyanti DNAM1 antibody, anti CD226 antigen antibody, anti DNAX accessory molecule 1 antibody, anti DNAM-1 antibody, anti CD226 antibody4320orb338982100 ulCD226 antibodyanti DNAM1 antibody, anti CD226 antigen antibody, anti DNAX accessory molecule 1 antibody, anti DNAM-1 antibody, anti CD226 antibody3870orb362370400 ugCD226 antibody6030orb362370100 ugCD226 antibody3420orb362370200 ugCD226 antibody4680orb164038400 ulCD226 antibodyAnti CD226 antibody, anti DNAM1 antibody, anti CD226 antigen antibody, anti DNAX accessory molecule 1 antibody, anti CD_antigen=CD226 antibody, anti Flags: Precursor antibody4050This CD226 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 307-335 amino acids from the C-terminal region of human CD226.orb4146450 ulCD226 antibody2520Recombinant human CD226 antigen proteinorb41464100 ulCD226 antibody3420Recombinant human CD226 antigen proteinorb23144150 TestsCD226 antibody (APC)4050orb231441100 TestsCD226 antibody (APC)6030orb3024090.1 mgCD226 antibody (Biotin)9810orb3024100.1 mgCD226 antibody (FITC)8550orb23144250 TestsCD226 antibody (FITC)4050orb231442100 TestsCD226 antibody (FITC)6030orb302411100 TestsCD226 antibody (PE)11250orb17148550 TestsCD226 antibody (PE)anti DNAM-1 antibody4050Recombinant Mouse CD226/DNAM-1 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD226/DNAM-1orb171485100 TestsCD226 antibody (PE)anti DNAM-1 antibody6030Recombinant Mouse CD226/DNAM-1 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD226/DNAM-1orb13306100 ugCD226/DNAM-1 antibodyanti-DNAM-1 antibody, anti-adhesion glycoprotein antibody, anti-CD226 antibody, anti-CD226gen antibody, anti-DNAM-1 antibody, anti-DNAM-1 (DNAX Accessory Molecule-1) antibody, anti-DNAX accessory molecule 1 antibody, anti-platelet and T cell activationgen 1 antibody, anti-PTA1 antibody, anti-TLiSA1 antibody3330Synthetic peptide (please contact us for details)orb13306200 ugCD226/DNAM-1 antibodyanti-DNAM-1 antibody, anti-adhesion glycoprotein antibody, anti-CD226 antibody, anti-CD226gen antibody, anti-DNAM-1 antibody, anti-DNAM-1 (DNAX Accessory Molecule-1) antibody, anti-DNAX accessory molecule 1 antibody, anti-platelet and T cell activationgen 1 antibody, anti-PTA1 antibody, anti-TLiSA1 antibody4500Synthetic peptide (please contact us for details)orb126701100 ugCD226/DNAM-1 antibody2880Synthesized non-phosphopeptide derived from human CD226/DNAM-1 around the phosphorylation site of serine 329 (T-F-SP-R-R).orb126701200 ugCD226/DNAM-1 antibody4140Synthesized non-phosphopeptide derived from human CD226/DNAM-1 around the phosphorylation site of serine 329 (T-F-SP-R-R).orb13882100 ugCD226/DNAM-1 antibody (FITC)anti-DNAM-1 antibody, anti-adhesion glycoprotein antibody, anti-CD226 antibody, anti-CD226gen antibody, anti-DNAM-1 antibody, anti-DNAM-1 (DNAX Accessory Molecule-1) antibody, anti-DNAX accessory molecule 1 antibody, anti-platelet and T cell activationgen 1 antibody, anti-PTA1 antibody, anti-TLiSA1 antibody3870Synthetic peptide (please contact us for details)orb984760.1 mgCD227 antibody5670orb3023520.2 mgCD227 antibody11700orb178426500 ulCD227 antibodyanti Mucin-1 antibody, anti EMA antibody6426peptide derived from C-terminal sequence of human Mucin-1orb1784261 mlCD227 antibodyanti Mucin-1 antibody, anti EMA antibody7650peptide derived from C-terminal sequence of human Mucin-1orb178426100 ulCD227 antibodyanti Mucin-1 antibody, anti EMA antibody3780peptide derived from C-terminal sequence of human Mucin-1orb178426200 ulCD227 antibodyanti Mucin-1 antibody, anti EMA antibody5094peptide derived from C-terminal sequence of human Mucin-1orb3023530.1 mgCD227 antibody (FITC)9090orb191561100 ulCD227/MUC1 (Phospho-Tyr1229) antibodyanti PUM antibody, anti EMA antibody, anti H23AG antibody, anti MUC-1 antibody, anti PEM antibody4716Peptide sequence around phosphorylation site of tyrosine 1229 S-P-Y(p)-E-K) derived from Human CD227/MUC1.orb229619100 ulCD227/MUC1 (Phospho-Tyr1229) antibodyanti Breast carcinoma-associated antigen DF3 antibody, anti CD227 antibody, anti Carcinoma-associated mucin antibody, anti EMA antibody, anti Episialin antibody, anti H23AG antibody, anti MUC-1 antibody, anti MUC1 antibody, anti Mucin 1 precursor antibody, anti PEM antibody, anti PEMT antibody, anti PUM antibody, anti Peanut-reactive urinary mucin antibody, anti Polymorphic epithelial mucin antibody, anti Tumor-associated epithelial membrane antigen antibody, anti T antibody3798A synthesized peptide derived from human CD227/MUC1orb22961920 ulCD227/MUC1 (Phospho-Tyr1229) antibodyanti Breast carcinoma-associated antigen DF3 antibody, anti CD227 antibody, anti Carcinoma-associated mucin antibody, anti EMA antibody, anti Episialin antibody, anti H23AG antibody, anti MUC-1 antibody, anti MUC1 antibody, anti Mucin 1 precursor antibody, anti PEM antibody, anti PEMT antibody, anti PUM antibody, anti Peanut-reactive urinary mucin antibody, anti Polymorphic epithelial mucin antibody, anti Tumor-associated epithelial membrane antigen antibody, anti T antibody2736A synthesized peptide derived from human CD227/MUC1orb22961950 ulCD227/MUC1 (Phospho-Tyr1229) antibodyanti Breast carcinoma-associated antigen DF3 antibody, anti CD227 antibody, anti Carcinoma-associated mucin antibody, anti EMA antibody, anti Episialin antibody, anti H23AG antibody, anti MUC-1 antibody, anti MUC1 antibody, anti Mucin 1 precursor antibody, anti PEM antibody, anti PEMT antibody, anti PUM antibody, anti Peanut-reactive urinary mucin antibody, anti Polymorphic epithelial mucin antibody, anti Tumor-associated epithelial membrane antigen antibody, anti T antibody3258A synthesized peptide derived from human CD227/MUC1orb984771 mlCD228 antibody4140orb447270.1 mgCD229 antibodyAnti-CD229 antibody, anti-Ly9 antibody3960orb2236340.1 mgCD229 antibody3690"CD299-transfected 300.19 pre-B cell line "orb3023810.2 mgCD229 antibody11250orb311219100 ulCD229 antibody4716KLH Conjugated synthetic peptideorb44729100 testsCD229 antibodyAnti-CD229 antibody, anti-Ly9 antibody5670orb256660200 ulCD229 antibodyanti T-lymphocyte surface antigen Ly-9 antibody, anti Cell surface molecule Ly-9 antibody, anti Lymphocyte antigen 9 antibody, anti Signaling lymphocytic activation molecule 3 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD229. The exact sequence is proprietary.orb256660100 ulCD229 antibodyanti T-lymphocyte surface antigen Ly-9 antibody, anti Cell surface molecule Ly-9 antibody, anti Lymphocyte antigen 9 antibody, anti Signaling lymphocytic activation molecule 3 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD229. The exact sequence is proprietary.orb13307100 ugCD229 antibodyanti-CD229 antibody, anti-Cell surface molecule Ly9 antibody, anti-hly9 antibody, anti-LY9 antibody, anti-Lymphocytegen 9 antibody, anti-mLY9 antibody, anti-SLAMF3 antibody, anti-T lymphocyte surfacegen Ly9 precursor antibody2970Synthetic peptide (please contact us for details)orb13307200 ugCD229 antibodyanti-CD229 antibody, anti-Cell surface molecule Ly9 antibody, anti-hly9 antibody, anti-LY9 antibody, anti-Lymphocytegen 9 antibody, anti-mLY9 antibody, anti-SLAMF3 antibody, anti-T lymphocyte surfacegen Ly9 precursor antibody3870Synthetic peptide (please contact us for details)orb3023820.1 mgCD229 antibody (Biotin)9810orb3023830.1 mgCD229 antibody (FITC)9090orb44728100 testsCD229 antibody (PE)Anti-CD229 antibody, anti-Ly9 antibody5670orb302384100 TestsCD229 antibody (PE)11250orb1817740.1 mgCD23 antibodyanti CD23 antibody56705E3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with splenocytes from a BALB/c mouse immunized with Daudi cells, a human Burkitts lymphoma cell line.orb3021411 mlCD23 antibody17640orb3022621 mlCD23 antibody13680orb198036100 ugCD23 antibody3600orb389777100 ugCD23 antibody3690EBV-transformed human cellsorb254345100 ulCD23 antibody4716KLH conjugated synthetic peptideorb254375100 ulCD23 antibody4716KLH conjugated synthetic peptideorb308459200 ugCD23 antibodyanti CD23 antibody3780Daudi cell lineorb170607200 ugCD23 antibodyanti FCER2 antibody6030Recombinant Mouse CD23/FCER2 protein. Produced in rabbits immunized with purified, recombinant Mouse CD23/FCER2orb17060750 ugCD23 antibodyanti FCER2 antibody3420Recombinant Mouse CD23/FCER2 protein. Produced in rabbits immunized with purified, recombinant Mouse CD23/FCER2orb170607100 ugCD23 antibodyanti FCER2 antibody4680Recombinant Mouse CD23/FCER2 protein. Produced in rabbits immunized with purified, recombinant Mouse CD23/FCER2orb170914200 ugCD23 antibodyanti FCER2 antibody6030Recombinant Human CD23/FCER2 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD23/FCER2orb17091450 ugCD23 antibodyanti FCER2 antibody3420Recombinant Human CD23/FCER2 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD23/FCER2orb170914100 ugCD23 antibodyanti FCER2 antibody4680Recombinant Human CD23/FCER2 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD23/FCER2orb230092200 ugCD23 antibody6030orb23009250 ugCD23 antibody3420orb230092100 ugCD23 antibody4680orb323118200 ulCD23 antibodyanti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD23 antibody4410KLH-conjugated synthetic peptide encompassing a sequence of human CD23. The exact sequence is proprietary.orb323118100 ulCD23 antibodyanti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD23 antibody2970KLH-conjugated synthetic peptide encompassing a sequence of human CD23. The exact sequence is proprietary.orb248902200 ulCD23 antibodyanti FCER2 antibody, anti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD antigen CD23) antibody5220orb24890250 ulCD23 antibodyanti FCER2 antibody, anti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD antigen CD23) antibody3150orb248902100 ulCD23 antibodyanti FCER2 antibody, anti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD antigen CD23) antibody3600orb308462200 TestsCD23 antibodyanti CD23 antibody3780Daudi cell lineorb88836250 ulCD23 antibody6660orb170606400 ugCD23 antibodyanti FCER2 antibody6030Recombinant Mouse CD23/FCER2 protein. Produced in rabbits immunized with purified, recombinant Mouse CD23/FCER2orb170606100 ugCD23 antibodyanti FCER2 antibody3420Recombinant Mouse CD23/FCER2 protein. Produced in rabbits immunized with purified, recombinant Mouse CD23/FCER2orb170606200 ugCD23 antibodyanti FCER2 antibody4680Recombinant Mouse CD23/FCER2 protein. Produced in rabbits immunized with purified, recombinant Mouse CD23/FCER2orb230091400 ugCD23 antibody6030orb230091100 ugCD23 antibody3420orb230091200 ugCD23 antibody4680orb1330850 ugCD23 antibodyanti-# Lymphocyte IgE receptor antibody, anti-B6 antibody, anti-Blast2 antibody, anti-C type lectin domain family 4 member J antibody, anti-CD23 antibody, anti-CD23gen antibody, anti-CD23A antibody, anti-CLEC4J antibody, anti-C-type lectin domain family 4 antibody, anti-FC Epsilon RII antibody, anti-Fc fragment of IgE low affinity II receptor for antibody, anti-FC Receptor IgE Low Affinity II Alpha Polypeptide antibody, anti-FCE2 antibody, anti-FCER2 antibody, anti-FCER2A antibody, anti-IgE Binding Factor antibody, anti-IgE Receptor Lymphocyte antibody, anti-IGEBF antibody, anti-Immunoglobulin E binding factor antibody, anti-Low affinity immunoglobulin epsilon Fc receptor antibody, anti-Low Affinity immunoglobulin Epsilon FC Receptor Membrane Bound Form antibody, anti-Low Affinity Immunoglobulin Epsilon FC Receptor Soluble Form antibody, anti-Ly42 antibody, anti-Lymphocyte antibody, anti-member J antibody1800Synthetic peptide (please contact us for details)orb13308100 ugCD23 antibodyanti-# Lymphocyte IgE receptor antibody, anti-B6 antibody, anti-Blast2 antibody, anti-C type lectin domain family 4 member J antibody, anti-CD23 antibody, anti-CD23gen antibody, anti-CD23A antibody, anti-CLEC4J antibody, anti-C-type lectin domain family 4 antibody, anti-FC Epsilon RII antibody, anti-Fc fragment of IgE low affinity II receptor for antibody, anti-FC Receptor IgE Low Affinity II Alpha Polypeptide antibody, anti-FCE2 antibody, anti-FCER2 antibody, anti-FCER2A antibody, anti-IgE Binding Factor antibody, anti-IgE Receptor Lymphocyte antibody, anti-IGEBF antibody, anti-Immunoglobulin E binding factor antibody, anti-Low affinity immunoglobulin epsilon Fc receptor antibody, anti-Low Affinity immunoglobulin Epsilon FC Receptor Membrane Bound Form antibody, anti-Low Affinity Immunoglobulin Epsilon FC Receptor Soluble Form antibody, anti-Ly42 antibody, anti-Lymphocyte antibody, anti-member J antibody2970Synthetic peptide (please contact us for details)orb8934150 ugCD23 antibody6660orb17116650 ugCD23 antibodyanti FCER2 antibody4050Recombinant Human CD23/FCER2 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD23/FCER2orb171166100 ugCD23 antibodyanti FCER2 antibody6030Recombinant Human CD23/FCER2 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD23/FCER2orb23009050 ugCD23 antibody4050orb230090100 ugCD23 antibody6030orb23159550 ugCD23 antibody4050orb231595100 ugCD23 antibody6030orb36100650 ugCD23 antibody4050Recombinant mouse CD23/FCER2 Protein orb361006100 ugCD23 antibody6030Recombinant mouse CD23/FCER2 Protein orb197134500 ugCD23 antibodyanti CD23 antibody8370orb197134100 ugCD23 antibodyanti CD23 antibody5364orb197134200 ugCD23 antibodyanti CD23 antibody6516orb178500500 ulCD23 antibody8694peptide derived from C-terminal region of human CD23orb1785001 mlCD23 antibody13914peptide derived from C-terminal region of human CD23orb178500100 ulCD23 antibody6210peptide derived from C-terminal region of human CD23orb178500200 ulCD23 antibody6750peptide derived from C-terminal region of human CD23orb8716950 ugCD23 antibody7470orb389780100 testsCD23 antibody (APC)5670EBV-transformed human cellsorb23159150 TestsCD23 antibody (APC)4050orb231591100 TestsCD23 antibody (APC)6030orb19713550 ugCD23 antibody (Biotin)anti CD23 antibody (Biotin)6300orb178470100 testsCD23 antibody (FITC8856orb3018100.5 mlCD23 antibody (FITC)6480orb13854100 ugCD23 antibody (FITC)anti-# Lymphocyte IgE receptor antibody, anti-B6 antibody, anti-Blast2 antibody, anti-C type lectin domain family 4 member J antibody, anti-CD23 antibody, anti-CD23gen antibody, anti-CD23A antibody, anti-CLEC4J antibody, anti-C-type lectin domain family 4 antibody, anti-FC Epsilon RII antibody, anti-Fc fragment of IgE low affinity II receptor for antibody, anti-FC Receptor IgE Low Affinity II Alpha Polypeptide antibody, anti-FCE2 antibody, anti-FCER2 antibody, anti-FCER2A antibody, anti-IgE Binding Factor antibody, anti-IgE Receptor Lymphocyte antibody, anti-IGEBF antibody, anti-Immunoglobulin E binding factor antibody, anti-Low affinity immunoglobulin epsilon Fc receptor antibody, anti-Low Affinity immunoglobulin Epsilon FC Receptor Membrane Bound Form antibody, anti-Low Affinity Immunoglobulin Epsilon FC Receptor Soluble Form antibody, anti-Ly42 antibody, anti-Lymphocyte antibody, anti-member J antibody3870Synthetic peptide (please contact us for details)orb198092100 TestsCD23 antibody (FITC)4140orb308460100 TestsCD23 antibody (FITC)anti CD23 antibody3780Daudi cell lineorb389778100 testsCD23 antibody (FITC)4770EBV-transformed human cellsorb24874250 AssaysCD23 antibody (FITC)anti FCER2 antibody, anti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD antigen CD23) antibody3600orb248742100 AssaysCD23 antibody (FITC)anti FCER2 antibody, anti CD23A antibody, anti CLEC4J antibody, anti FCE2 antibody, anti IGEBF antibody, anti Low affinity immunoglobulin epsilon Fc receptor antibody, anti BLAST-2 antibody, anti C-type lectin domain family 4 member J antibody, anti Fc-epsilon-RII antibody, anti Immunoglobulin E-binding factor antibody, anti Lymphocyte IgE receptor antibody, anti CD antigen CD23) antibody4770orb23159350 TestsCD23 antibody (FITC)4050orb231593100 TestsCD23 antibody (FITC)6030orb198144100 TestsCD23 antibody (PE)4590orb308461100 TestsCD23 antibody (PE)anti CD23 antibody4230Daudi cell lineorb389779100 testsCD23 antibody (PE)5670EBV-transformed human cellsorb23159450 TestsCD23 antibody (PE)4050orb231594100 TestsCD23 antibody (PE)6030orb23159250 TestsCD23 antibody (PerCP)4050orb231592100 TestsCD23 antibody (PerCP)6030orb447100.1 mgCD230 antibodyAnti-CD230 antibody, anti-Human Prion Protein (PrP) antibody6120orb311532100 ulCD232 antibody4716KLH Conjugated synthetic peptideorb339139200 ulCD232 antibodyanti VESPR antibody, anti Plexin-C1 antibody, anti Virus-encoded semaphorin protein receptor antibody, anti CD232 antibody4320orb339139100 ulCD232 antibodyanti VESPR antibody, anti Plexin-C1 antibody, anti Virus-encoded semaphorin protein receptor antibody, anti CD232 antibody3870orb229947200 ugCD233 antibody6030orb22994750 ugCD233 antibody3420orb229947100 ugCD233 antibody4680orb223349200 ugCD234 antibodyanti CD234 antibody4140Synthesized peptide derived from internal of human CD234.orb223349100 ugCD234 antibodyanti CD234 antibody2880Synthesized peptide derived from internal of human CD234.orb234798200 ulCD234 antibodyanti ACKR1 antibody, anti FY antibody, anti GPD antibody, anti Duffy antigen/chemokine receptor antibody, anti Atypical chemokine receptor 1 antibody, anti Fy glycoprotein antibody, anti GpFy antibody, anti Glycoprotein D antibody, anti Plasmodium vivax receptor antibody, anti CD234 antibody4410orb234798100 ulCD234 antibodyanti ACKR1 antibody, anti FY antibody, anti GPD antibody, anti Duffy antigen/chemokine receptor antibody, anti Atypical chemokine receptor 1 antibody, anti Fy glycoprotein antibody, anti GpFy antibody, anti Glycoprotein D antibody, anti Plasmodium vivax receptor antibody, anti CD234 antibody2970orb12147100 ugCD235 antibodyanti-CD235 antibody2700orb12147500 ugCD235 antibodyanti-CD235 antibody5040orb1214850 TestsCD235 antibody (FITC)anti-CD235 antibody (FITC)2970orb12148100 TestsCD235 antibody (FITC)anti-CD235 antibody (FITC)3870orb1214950 TestsCD235 antibody (PE)anti-CD235 antibody (PE)2970orb12149100 TestsCD235 antibody (PE)anti-CD235 antibody (PE)4050orb438470.1 mgCD235a antibodyAnti-CD235a antibody, anti-Glycophorin A antibody3960orb2227830.1 mgCD235a antibodyGlycophorin A3690Membrane preparation from splenic hairy cell leukemiaorb302301100 ugCD235a antibody5850orb13442100 ugCD235a antibodyanti-AI853584 antibody, anti-Blood group--MN locus antibody, anti-CD235a antibody, anti-CD235agen antibody, anti-Glycophorin A antibody, anti-Glycophorin A (MNS blood group) antibody, anti-Glycophorin A includes MN blood group antibody, anti-Glycophorin A precursor antibody, anti-GPA antibody, anti-GPErik antibody, anti-GpMiIII antibody, anti-GPSAT antibody, anti-GYPA antibody, anti-HGpMiIII antibody, anti-HGpMiV antibody, anti-HGpMiX antibody, anti-HGpMiXI antibody, anti-HGpSta antibody, anti-MN antibody, anti-MNS antibody2970Synthetic peptide (please contact us for details)orb13442200 ugCD235a antibodyanti-AI853584 antibody, anti-Blood group--MN locus antibody, anti-CD235a antibody, anti-CD235agen antibody, anti-Glycophorin A antibody, anti-Glycophorin A (MNS blood group) antibody, anti-Glycophorin A includes MN blood group antibody, anti-Glycophorin A precursor antibody, anti-GPA antibody, anti-GPErik antibody, anti-GpMiIII antibody, anti-GPSAT antibody, anti-GYPA antibody, anti-HGpMiIII antibody, anti-HGpMiV antibody, anti-HGpMiX antibody, anti-HGpMiXI antibody, anti-HGpSta antibody, anti-MN antibody, anti-MNS antibody3870Synthetic peptide (please contact us for details)orb311543100 ulCD235a antibody4716KLH Conjugated synthetic peptideorb339143200 ulCD235a antibodyanti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD235a antibody4320orb339143100 ulCD235a antibodyanti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD235a antibody3870orb248903200 ulCD235a antibodyanti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody5220orb24890350 ulCD235a antibodyanti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody3150orb248903100 ulCD235a antibodyanti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody3600orb96585250 ulCD235a antibodyanti Glycophorin A antibody7470Membrane preparation from splenic hairy cell leukemiaorb8788550 ugCD235a antibodyanti Glycophorin A antibody6660orb8825250 ugCD235a antibodyanti Glycophorin A antibody6660orb8863650 ugCD235a antibodyanti Glycophorin A antibody6660orb9619250 ugCD235a antibodyanti Glycophorin A antibody6660orb14001100 ugCD235a antibody (FITC)anti-AI853584 antibody, anti-Blood group--MN locus antibody, anti-CD235a antibody, anti-CD235agen antibody, anti-Glycophorin A antibody, anti-Glycophorin A (MNS blood group) antibody, anti-Glycophorin A includes MN blood group antibody, anti-Glycophorin A precursor antibody, anti-GPA antibody, anti-GPErik antibody, anti-GpMiIII antibody, anti-GPSAT antibody, anti-GYPA antibody, anti-HGpMiIII antibody, anti-HGpMiV antibody, anti-HGpMiX antibody, anti-HGpMiXI antibody, anti-HGpSta antibody, anti-MN antibody, anti-MNS antibody3870Synthetic peptide (please contact us for details)orb43848100 testsCD235a antibody (FITC)Anti-CD235a antibody, anti-Glycophorin A antibody4770orb222784100 testsCD235a antibody (FITC)Glycophorin A4770Membrane preparation from splenic hairy cell leukemiaorb24874350 AssaysCD235a antibody (FITC)anti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody3600orb248743100 AssaysCD235a antibody (FITC)anti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody4770orb43849100 testsCD235a antibody (PE)Anti-CD235a antibody, anti-Glycophorin A antibody5670orb222785100 testsCD235a antibody (PE)Glycophorin A5670Membrane preparation from splenic hairy cell leukemiaorb24881550 AssaysCD235a antibody (PE)anti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody4050orb248815100 AssaysCD235a antibody (PE)anti GYPA antibody, anti GPA antibody, anti Glycophorin-A antibody, anti MN sialoglycoprotein antibody, anti PAS-2 antibody, anti Sialoglycoprotein alpha antibody, anti CD antigen CD235a antibody5940orb3023720.2 mgCD236 antibody10260orb3023750.2 mgCD238 antibody10260orb361587200 ugCD238 antibody6030A synthetic peptide corresponding to the N-terminus of the human CD238orb36158750 ugCD238 antibody3420A synthetic peptide corresponding to the N-terminus of the human CD238orb361587100 ugCD238 antibody4680A synthetic peptide corresponding to the N-terminus of the human CD238orb3023710.2 mgCD239 antibody10260orb101161100 ugCD239 antibodyanti-AU antibodyAuberger B antigen antibody, anti-B CAM cell surface glycoprotein antibody, anti-B cell adhesion molecule antibody, anti-B-CAM cell surface glycoprotein antibody, anti-Basal cell adhesion molecule antibody, anti-Basal cell adhesion molecule Lu and Au blood groups antibody, anti-Basal cell adhesion molecule Lutheran blood group antibody, anti-Bcam antibody, anti-BCAM_HUMAN antibody, anti-CD239 antibody, anti-CD239 antigen antibody, anti-G253 antigen antibody, anti-Glycoprotein 95kDa antibody, anti-LU antibody, anti-Lutheran antibody, anti-Lutheran antigen antibody, anti-Lutheran blood group (Auberger b antigen included) antibody, anti-Lutheran blood group Auberger b antigen included antibody, anti-Lutheran blood group glycoprotein antibody, anti-MSK19. antibody3330orb101161200 ugCD239 antibodyanti-AU antibodyAuberger B antigen antibody, anti-B CAM cell surface glycoprotein antibody, anti-B cell adhesion molecule antibody, anti-B-CAM cell surface glycoprotein antibody, anti-Basal cell adhesion molecule antibody, anti-Basal cell adhesion molecule Lu and Au blood groups antibody, anti-Basal cell adhesion molecule Lutheran blood group antibody, anti-Bcam antibody, anti-BCAM_HUMAN antibody, anti-CD239 antibody, anti-CD239 antigen antibody, anti-G253 antigen antibody, anti-Glycoprotein 95kDa antibody, anti-LU antibody, anti-Lutheran antibody, anti-Lutheran antigen antibody, anti-Lutheran blood group (Auberger b antigen included) antibody, anti-Lutheran blood group Auberger b antigen included antibody, anti-Lutheran blood group glycoprotein antibody, anti-MSK19. antibody4500orb311389100 ulCD239 antibody4716KLH Conjugated synthetic peptideorb102269100 ugCD239 antibody (FITC)anti-AU antibodyAuberger B antigen antibody, anti-B CAM cell surface glycoprotein antibody, anti-B cell adhesion molecule antibody, anti-B-CAM cell surface glycoprotein antibody, anti-Basal cell adhesion molecule antibody, anti-Basal cell adhesion molecule Lu and Au blood groups antibody, anti-Basal cell adhesion molecule Lutheran blood group antibody, anti-Bcam antibody, anti-BCAM_HUMAN antibody, anti-CD239 antibody, anti-CD239 antigen antibody, anti-Glycoprotein 95kDa antibody, anti-LU antibody, anti-Lutheran antibody, anti-Lutheran antigen antibody, anti-Lutheran blood group (Auberger b antigen included) antibody, anti-Lutheran blood group Auberger b antigen included antibody, anti-Lutheran blood group glycoprotein antibody, anti-MSK19. antibody3870orb444920.1 mgCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody4590orb264920.2 mgCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody8712Human bone marrow malignant cells from a non-B, non-T acute leukemia.orb3720091 mlCD24 antibody7740orb160316100 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody2970Synthesized peptide derived from the N-terminal region of human CD24.orb348960100 ugCD24 antibodyanti-CD 24 antibody, anti-CD24 antibody, anti-CD24 antigen (small cell lung carcinoma cluster 4 antigen) antibody, anti-CD24 antigen antibody, anti-CD24 molecule antibody, anti-CD24_HUMAN antibody, anti-CD24A antibody, anti-FLJ22950 antibody, anti-FLJ43543 antibody, anti-GPI linked surface mucin antibody, anti-Heat stable antigen antibody, anti-HSA antibody, anti-MGC75043 antibody, anti-Nectadrin antibody, anti-Signal transducer CD24 antibody, anti-Small cell lung carcinoma cluster 4 antigen antibody3330orb10309100 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody3330orb10309200 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody4500orb2941100 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody2970Synthetic peptide (please contact us for details)orb2941200 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody3870Synthetic peptide (please contact us for details)orb2951100 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody2970Synthetic peptide (please contact us for details)orb2951200 ugCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody3870Synthetic peptide (please contact us for details)orb319443100 ugCD24 antibody2970orb319443200 ugCD24 antibody3870orb13105100 ulCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody4230This antibody is produced by immunizing rabbits with a synthetic peptide (KLH-coupled) corresponding to a region of N-terminal residues of mouse CD24.orb13106100 ulCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody4230This antibody is produced by immunizing rabbits with a synthetic peptide (KLH-coupled) corresponding to a region of N-terminal residues of human CD24.orb153474100 ulCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody3960Purified recombinant fragment of human CD24 expressed in E. Coli.orb195839100 ulCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody4230orb253813100 ulCD24 antibodyanti CD 24 antibody, anti CD24 antibody, anti CD-24 antibody, anti CD24 antigen antibody, anti CD24 molecule antibody, anti CD24A antibody, anti GPI linked surface mucin antibody, anti GPI linked surface mucin antibody, anti Heat stable antigen antibody, anti HSA antibody, anti Nectadrin antibody, anti Signal transducer CD24 antibody4716KLH conjugated synthetic peptideorb337315100 ulCD24 antibody3798A synthesized peptide derived from human CD24orb33731550 ulCD24 antibody3258A synthesized peptide derived from human CD24orb13709450 ulCD24 antibodyanti CD24 antibody3060Recombinant protein of human CD24orb137094100 ulCD24 antibodyanti CD24 antibody4140Recombinant protein of human CD24orb137094200 ulCD24 antibodyanti CD24 antibody6480Recombinant protein of human CD24orb111554100 ulCD24 antibody (Alexa 488)Cluster Of Differentiation 24 antibody (Alexa 488), CD 24 antibody (Alexa 488), CD24gen antibody (Alexa 488), CD24 molecule antibody (Alexa 488), CD24A antibody (Alexa 488), FLJ22950 antibody (Alexa 488), FLJ43543 antibody (Alexa 488), GPI linked surface mucin antibody (Alexa 488), Heat stablegen antibody (Alexa 488), HSA antibody (Alexa 488), MGC75043 antibody (Alexa 488), Nectadrin antibody (Alexa 488), Signal transducer CD24 antibody (Alexa 488), Small cell lung carcinoma cluster 4gen antibody (Alexa 488)3870Synthetic peptide (Please contact us for more details)orb111062100 ulCD24 antibody (Alexa Fluor 350)Cluster Of Differentiation 24 antibody (Alexa Fluor 350), CD 24 antibody (Alexa Fluor 350), CD24gen antibody (Alexa Fluor 350), CD24 molecule antibody (Alexa Fluor 350), CD24A antibody (Alexa Fluor 350), FLJ22950 antibody (Alexa Fluor 350), FLJ43543 antibody (Alexa Fluor 350), GPI linked surface mucin antibody (Alexa Fluor 350), Heat stablegen antibody (Alexa Fluor 350), HSA antibody (Alexa Fluor 350), MGC75043 antibody (Alexa Fluor 350), Nectadrin antibody (Alexa Fluor 350), Signal transducer CD24 antibody (Alexa Fluor 350), Small cell lung carcinoma cluster 4gen antibody (Alexa Fluor 350)3870Synthetic peptide (Please contact us for more details)orb113523100 ulCD24 antibody (Alkaline Phosphatase)anti CD 24 antibody (Alkaline Phosphatase), anti CD24 antibody (Alkaline Phosphatase), anti CD-24 antibody (Alkaline Phosphatase), anti CD24 antigen antibody (Alkaline Phosphatase), anti CD24 molecule antibody (Alkaline Phosphatase), anti CD24A antibody (Alkaline Phosphatase), anti GPI linked surface mucin antibody (Alkaline Phosphatase), anti GPI linked surface mucin antibody (Alkaline Phosphatase), anti Heat stable antigen antibody (Alkaline Phosphatase), anti HSA antibody (Alkaline Phosphatase), anti Nectadrin antibody (Alkaline Phosphatase), anti Signal transducer CD24 antibody (Alkaline Phosphatase)3870Synthetic peptide (Please contact us for more details)orb222820100 testsCD24 antibody (APC)anti CD 24 antibody (APC), anti CD24 antibody (APC), anti CD-24 antibody (APC), anti CD24 antigen antibody (APC), anti CD24 molecule antibody (APC), anti CD24A antibody (APC), anti GPI linked surface mucin antibody (APC), anti GPI linked surface mucin antibody (APC), anti Heat stable antigen antibody (APC), anti HSA antibody (APC), anti Nectadrin antibody (APC), anti Signal transducer CD24 antibody (APC)5670Glycoproteins purified from human NALM-1 cell line.orb114016100 ulCD24 antibody (Biotin)anti CD 24 antibody (Biotin), anti CD24 antibody (Biotin), anti CD-24 antibody (Biotin), anti CD24 antigen antibody (Biotin), anti CD24 molecule antibody (Biotin), anti CD24A antibody (Biotin), anti GPI linked surface mucin antibody (Biotin), anti GPI linked surface mucin antibody (Biotin), anti Heat stable antigen antibody (Biotin), anti HSA antibody (Biotin), anti Nectadrin antibody (Biotin), anti Signal transducer CD24 antibody (Biotin)3870Synthetic peptide (Please contact us for more details)orb114508100 ulCD24 antibody (Cy3)anti CD 24 antibody (Cy3), anti CD24 antibody (Cy3), anti CD-24 antibody (Cy3), anti CD24 antigen antibody (Cy3), anti CD24 molecule antibody (Cy3), anti CD24A antibody (Cy3), anti GPI linked surface mucin antibody (Cy3), anti GPI linked surface mucin antibody (Cy3), anti Heat stable antigen antibody (Cy3), anti HSA antibody (Cy3), anti Nectadrin antibody (Cy3), anti Signal transducer CD24 antibody (Cy3)3870Synthetic peptide (Please contact us for more details)orb122458100 ulCD24 antibody (Cy5)anti CD 24 antibody (Cy5), anti CD24 antibody (Cy5), anti CD-24 antibody (Cy5), anti CD24 antigen antibody (Cy5), anti CD24 molecule antibody (Cy5), anti CD24A antibody (Cy5), anti GPI linked surface mucin antibody (Cy5), anti GPI linked surface mucin antibody (Cy5), anti Heat stable antigen antibody (Cy5), anti HSA antibody (Cy5), anti Nectadrin antibody (Cy5), anti Signal transducer CD24 antibody (Cy5)3870Synthetic peptide (Please contact us for more details)orb123041100 ulCD24 antibody (Cy5.5)anti CD 24 antibody (Cy5.5), anti CD24 antibody (Cy5.5), anti CD-24 antibody (Cy5.5), anti CD24 antigen antibody (Cy5.5), anti CD24 molecule antibody (Cy5.5), anti CD24A antibody (Cy5.5), anti GPI linked surface mucin antibody (Cy5.5), anti GPI linked surface mucin antibody (Cy5.5), anti Heat stable antigen antibody (Cy5.5), anti HSA antibody (Cy5.5), anti Nectadrin antibody (Cy5.5), anti Signal transducer CD24 antibody (Cy5.5)3870Synthetic peptide (Please contact us for more details)orb123533100 ulCD24 antibody (Cy7)anti CD 24 antibody (Cy7), anti CD24 antibody (Cy7), anti CD-24 antibody (Cy7), anti CD24 antigen antibody (Cy7), anti CD24 molecule antibody (Cy7), anti CD24A antibody (Cy7), anti GPI linked surface mucin antibody (Cy7), anti GPI linked surface mucin antibody (Cy7), anti Heat stable antigen antibody (Cy7), anti HSA antibody (Cy7), anti Nectadrin antibody (Cy7), anti Signal transducer CD24 antibody (Cy7)3870Synthetic peptide (Please contact us for more details)orb15287100 ugCD24 antibody (FITC)anti CD 24 antibody (FITC), anti CD24 antibody (FITC), anti CD-24 antibody (FITC), anti CD24 antigen antibody (FITC), anti CD24 molecule antibody (FITC), anti CD24A antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti Heat stable antigen antibody (FITC), anti HSA antibody (FITC), anti Nectadrin antibody (FITC), anti Signal transducer CD24 antibody (FITC)3870Synthetic peptide (please contact us for details)orb7872100 ugCD24 antibody (FITC)anti CD 24 antibody (FITC), anti CD24 antibody (FITC), anti CD-24 antibody (FITC), anti CD24 antigen antibody (FITC), anti CD24 molecule antibody (FITC), anti CD24A antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti Heat stable antigen antibody (FITC), anti HSA antibody (FITC), anti Nectadrin antibody (FITC), anti Signal transducer CD24 antibody (FITC)3870Synthetic peptide (please contact us for details)orb7882100 ugCD24 antibody (FITC)anti CD 24 antibody (FITC), anti CD24 antibody (FITC), anti CD-24 antibody (FITC), anti CD24 antigen antibody (FITC), anti CD24 molecule antibody (FITC), anti CD24A antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti Heat stable antigen antibody (FITC), anti HSA antibody (FITC), anti Nectadrin antibody (FITC), anti Signal transducer CD24 antibody (FITC)3870Synthetic peptide (please contact us for details)orb360881100 ugCD24 antibody (FITC)3330Synthetic peptide (please contact us for details)orb44493100 testsCD24 antibody (FITC)anti CD 24 antibody (FITC), anti CD24 antibody (FITC), anti CD-24 antibody (FITC), anti CD24 antigen antibody (FITC), anti CD24 molecule antibody (FITC), anti CD24A antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti GPI linked surface mucin antibody (FITC), anti Heat stable antigen antibody (FITC), anti HSA antibody (FITC), anti Nectadrin antibody (FITC), anti Signal transducer CD24 antibody (FITC)4770orb110076100 ulCD24 antibody (HRP)anti CD 24 antibody (HRP), anti CD24 antibody (HRP), anti CD-24 antibody (HRP), anti CD24 antigen antibody (HRP), anti CD24 molecule antibody (HRP), anti CD24A antibody (HRP), anti GPI linked surface mucin antibody (HRP), anti GPI linked surface mucin antibody (HRP), anti Heat stable antigen antibody (HRP), anti HSA antibody (HRP), anti Nectadrin antibody (HRP), anti Signal transducer CD24 antibody (HRP)3870Synthetic peptide (Please contact us for more details)orb124517100 ulCD24 antibody (PE)anti CD 24 antibody (PE), anti CD24 antibody (PE), anti CD-24 antibody (PE), anti CD24 antigen antibody (PE), anti CD24 molecule antibody (PE), anti CD24A antibody (PE), anti GPI linked surface mucin antibody (PE), anti GPI linked surface mucin antibody (PE), anti Heat stable antigen antibody (PE), anti HSA antibody (PE), anti Nectadrin antibody (PE), anti Signal transducer CD24 antibody (PE)3870Synthetic peptide (Please contact us for more details)orb44494100 testsCD24 antibody (PE)anti CD 24 antibody (PE), anti CD24 antibody (PE), anti CD-24 antibody (PE), anti CD24 antigen antibody (PE), anti CD24 molecule antibody (PE), anti CD24A antibody (PE), anti GPI linked surface mucin antibody (PE), anti GPI linked surface mucin antibody (PE), anti Heat stable antigen antibody (PE), anti HSA antibody (PE), anti Nectadrin antibody (PE), anti Signal transducer CD24 antibody (PE)5670orb125294100 ulCD24 antibody (PE-Cy3)anti CD 24 antibody (PE-Cy3), anti CD24 antibody (PE-Cy3), anti CD-24 antibody (PE-Cy3), anti CD24 antigen antibody (PE-Cy3), anti CD24 molecule antibody (PE-Cy3), anti CD24A antibody (PE-Cy3), anti GPI linked surface mucin antibody (PE-Cy3), anti GPI linked surface mucin antibody (PE-Cy3), anti Heat stable antigen antibody (PE-Cy3), anti HSA antibody (PE-Cy3), anti Nectadrin antibody (PE-Cy3), anti Signal transducer CD24 antibody (PE-Cy3)3870Synthetic peptide (Please contact us for more details)orb129796100 ulCD24 antibody (PE-Cy5)anti CD 24 antibody (PE-Cy5), anti CD24 antibody (PE-Cy5), anti CD-24 antibody (PE-Cy5), anti CD24 antigen antibody (PE-Cy5), anti CD24 molecule antibody (PE-Cy5), anti CD24A antibody (PE-Cy5), anti GPI linked surface mucin antibody (PE-Cy5), anti GPI linked surface mucin antibody (PE-Cy5), anti Heat stable antigen antibody (PE-Cy5), anti HSA antibody (PE-Cy5), anti Nectadrin antibody (PE-Cy5), anti Signal transducer CD24 antibody (PE-Cy5)3870Synthetic peptide (Please contact us for more details)orb130288100 ulCD24 antibody (PE-Cy5.5)anti CD 24 antibody (PE-Cy5.5), anti CD24 antibody (PE-Cy5.5), anti CD-24 antibody (PE-Cy5.5), anti CD24 antigen antibody (PE-Cy5.5), anti CD24 molecule antibody (PE-Cy5.5), anti CD24A antibody (PE-Cy5.5), anti GPI linked surface mucin antibody (PE-Cy5.5), anti GPI linked surface mucin antibody (PE-Cy5.5), anti Heat stable antigen antibody (PE-Cy5.5), anti HSA antibody (PE-Cy5.5), anti Nectadrin antibody (PE-Cy5.5), anti Signal transducer CD24 antibody (PE-Cy5.5)3870Synthetic peptide (Please contact us for more details)orb130780100 ulCD24 antibody (PE-Cy7)anti CD 24 antibody (PE-Cy7), anti CD24 antibody (PE-Cy7), anti CD-24 antibody (PE-Cy7), anti CD24 antigen antibody (PE-Cy7), anti CD24 molecule antibody (PE-Cy7), anti CD24A antibody (PE-Cy7), anti GPI linked surface mucin antibody (PE-Cy7), anti GPI linked surface mucin antibody (PE-Cy7), anti Heat stable antigen antibody (PE-Cy7), anti HSA antibody (PE-Cy7), anti Nectadrin antibody (PE-Cy7), anti Signal transducer CD24 antibody (PE-Cy7)3870Synthetic peptide (Please contact us for more details)orb131272100 ulCD24 antibody (RBITC)anti CD 24 antibody (RBITC), anti CD24 antibody (RBITC), anti CD-24 antibody (RBITC), anti CD24 antigen antibody (RBITC), anti CD24 molecule antibody (RBITC), anti CD24A antibody (RBITC), anti GPI linked surface mucin antibody (RBITC), anti GPI linked surface mucin antibody (RBITC), anti Heat stable antigen antibody (RBITC), anti HSA antibody (RBITC), anti Nectadrin antibody (RBITC), anti Signal transducer CD24 antibody (RBITC)3870Synthetic peptide (Please contact us for more details)orb311531100 ulCD240d antibody4716KLH Conjugated synthetic peptideorb311231100 ulCD241 antibody4716KLH Conjugated synthetic peptideorb4843100 ugCD244 (phospho-Tyr266) antibodyanti-CD244 (phospho-Tyr266) antibody, anti-NKR2B4 antibody, anti-SLAMF4 antibody, anti-natural killer cell receptor 2B4 isoform 2 precursor antibody, anti-2B4 antibody, anti-C9 antibody1 antibody, anti-CD244 antigen antibody, anti-CD244 molecule natural killer cell receptor 2B4 antibody, anti-CD244 natural killer cell receptor 2B4 antibody, anti-F730046O15Rik antibody, anti-h2B4 antibody, anti-Ly90 antibody, anti-NAIL antibody, anti-Natural killer cell activation-inducing ligand antibody, anti-Natural killer cell receptor 2B4 antibody, anti-NK cell activation inducing ligand antibody, anti-NK cell activation inducing ligand NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-Nmrk antibody, anti-Non-MHC restricted killing associated antibody, anti-OTTHUMP00000027884 antibody, anti-p38 antibody, anti-SLAM family, member 4 antibody3870KLH conjugated synthetic phosphopeptide derived from human CD244 around the phosphorylation site of Tyr266. Please contact us for the exact immunogen sequence.orb7691100 ugCD244 (phospho-Tyr266) antibody (FITC)anti-CD244 (phospho-Tyr266) antibody, anti-NKR2B4 antibody, anti-SLAMF4 antibody, anti-natural killer cell receptor 2B4 isoform 2 precursor antibody, anti-2B4 antibody, anti-C9 antibody1 antibody, anti-CD244 antigen antibody, anti-CD244 molecule natural killer cell receptor 2B4 antibody, anti-CD244 natural killer cell receptor 2B4 antibody, anti-F730046O15Rik antibody, anti-h2B4 antibody, anti-Ly90 antibody, anti-NAIL antibody, anti-Natural killer cell activation-inducing ligand antibody, anti-Natural killer cell receptor 2B4 antibody, anti-NK cell activation inducing ligand antibody, anti-NK cell activation inducing ligand NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-Nmrk antibody, anti-Non-MHC restricted killing associated antibody, anti-OTTHUMP00000027884 antibody, anti-p38 antibody, anti-SLAM family, member 4 antibody3870KLH conjugated synthetic phosphopeptide derived from human CD244 around the phosphorylation site of Tyr266. Please contact us for the exact immunogen sequence.orb125000100 ugCD244 antibodyanti CD244 antibody, anti CD244 molecule, natural killer cell receptor 2B4 antibody, anti 2B4 antibody, anti NAIL antibody, anti NKR2B4 antibody, anti Nmrk antibody, anti SLAMF4 antibody, anti CD244 natural killer cell receptor 2B4 antibody, anti NK cell activation inducing ligand NAIL antibody, anti natural killer cell receptor 2B4 antibody4500orb99219100 ugCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti h2B4 antibody, anti NKR2B4 antibody, anti Nmrk antibody, anti SLAMF4 antibody, anti CD244 natural killer cell receptor 2B4 antibody, anti natural killer cell receptor 2B4 antibody, anti NK cell activation-inducing ligand antibody, anti NK cell type I receptor protein 2B4 antibody, anti NATURAL KILLER CELL ACTIVATION-INDUCING LIGAND antibody, anti SLAM FAMILY, MEMBER 4 antibody4140A synthetic peptide corresponding to a sequence at the C-terminus of human CD244(357-370aa RLSRKELENFDVYS).orb13331100 ugCD244 antibodyAnti-NKR2B4 antibody, anti-SLAMF4 antibody, anti-natural killer cell receptor 2B4 isoform 2 precursor antibody, anti-2B4 antibody, anti-C9.1 antibody, anti-CD244 antigen antibody, anti-CD244 molecule natural killer cell receptor 2B4 antibody, anti-CD244 natural killer cell receptor 2B4 antibody, anti-F730046O15Rik antibody, anti-h2B4 antibody, anti-Ly90 antibody, anti-NAIL antibody, anti-Natural killer cell activation-inducing ligand antibody, anti-Natural killer cell receptor 2B4 antibody, anti-NK cell activation inducing ligand antibody, anti-NK cell activation inducing ligand NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-Nmrk antibody, anti-Non-MHC restricted killing associated antibody, anti-OTTHUMP00000027884 antibody, anti-p38 antibody, anti-SLAM family antibody, anti-member 4 antibody.3330Synthetic peptide (please contact us for details)orb13331200 ugCD244 antibodyAnti-NKR2B4 antibody, anti-SLAMF4 antibody, anti-natural killer cell receptor 2B4 isoform 2 precursor antibody, anti-2B4 antibody, anti-C9.1 antibody, anti-CD244 antigen antibody, anti-CD244 molecule natural killer cell receptor 2B4 antibody, anti-CD244 natural killer cell receptor 2B4 antibody, anti-F730046O15Rik antibody, anti-h2B4 antibody, anti-Ly90 antibody, anti-NAIL antibody, anti-Natural killer cell activation-inducing ligand antibody, anti-Natural killer cell receptor 2B4 antibody, anti-NK cell activation inducing ligand antibody, anti-NK cell activation inducing ligand NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-Nmrk antibody, anti-Non-MHC restricted killing associated antibody, anti-OTTHUMP00000027884 antibody, anti-p38 antibody, anti-SLAM family antibody, anti-member 4 antibody.4500Synthetic peptide (please contact us for details)orb192454100 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody4716Recombinant protein of human CD244.orb311521100 ulCD244 antibody4716KLH Conjugated synthetic peptideorb228876100 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody, anti antibody3798Recombinant protein of human CD244orb22887620 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody, anti antibody2736Recombinant protein of human CD244orb22887650 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody, anti antibody3258Recombinant protein of human CD244orb377974200 ulCD244 antibody6210Recombinant full length protein of human CD244orb377974100 ulCD244 antibody4050Recombinant full length protein of human CD244orb35356650 ulCD244 antibodyanti-NK cell activation-inducing ligand antibody, anti-NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-NKR2B4 antibody, anti-h2B4 antibody, anti-SLAM family member 4 antibody, anti-SLAMF4 antibody, anti-Signaling lymphocytic activation molecule 4 antibody, anti-CD244 antibody, anti-2B4 antibody2520Recombinant human Natural killer cell receptor 2B4 protein (22-224aa)orb353566100 ulCD244 antibodyanti-NK cell activation-inducing ligand antibody, anti-NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-NKR2B4 antibody, anti-h2B4 antibody, anti-SLAM family member 4 antibody, anti-SLAMF4 antibody, anti-Signaling lymphocytic activation molecule 4 antibody, anti-CD244 antibody, anti-2B4 antibody3420Recombinant human Natural killer cell receptor 2B4 protein (22-224aa)orb16714250 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody3060Recombinant protein of human CD244orb167142100 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody4140Recombinant protein of human CD244orb167142200 ulCD244 antibodyanti 2B4 antibody, anti NAIL antibody, anti Nmrk antibody, anti NKR2B4 antibody, anti SLAMF4 antibody6480Recombinant protein of human CD244orb13884100 ugCD244 antibody (FITC)Anti-NKR2B4 antibody, anti-SLAMF4 antibody, anti-natural killer cell receptor 2B4 isoform 2 precursor antibody, anti-2B4 antibody, anti-C9.1 antibody, anti-CD244 antigen antibody, anti-CD244 molecule natural killer cell receptor 2B4 antibody, anti-CD244 natural killer cell receptor 2B4 antibody, anti-F730046O15Rik antibody, anti-h2B4 antibody, anti-Ly90 antibody, anti-NAIL antibody, anti-Natural killer cell activation-inducing ligand antibody, anti-Natural killer cell receptor 2B4 antibody, anti-NK cell activation inducing ligand antibody, anti-NK cell activation inducing ligand NAIL antibody, anti-NK cell type I receptor protein 2B4 antibody, anti-Nmrk antibody, anti-Non-MHC restricted killing associated antibody, anti-OTTHUMP00000027884 antibody, anti-p38 antibody, anti-SLAM family antibody, anti-member 4 antibody.3870Synthetic peptide (please contact us for details)orb394686100 ugCD246 antibody6552anaplastic lymphoma receptor tyrosine kinaseorb394687100 ugCD246 antibody6552anaplastic lymphoma receptor tyrosine kinaseorb3023310.2 mgCD247 antibody11700orb361951200 ugCD247 antibody6030Recombinant human CD247/CD3-ZETA Protein orb36195150 ugCD247 antibody3420Recombinant human CD247/CD3-ZETA Protein orb361951100 ugCD247 antibody4680Recombinant human CD247/CD3-ZETA Protein orb5119450 ugCD247 antibody3420Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb51194100 ugCD247 antibody5130Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb5119750 ugCD247 antibody (Biotin)3420Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb51197100 ugCD247 antibody (Biotin)5130Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb3023320.1 mgCD247 antibody (FITC)10440orb5119650 ugCD247 antibody (FITC)3420Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb51196100 ugCD247 antibody (FITC)5130Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb5119550 ugCD247 antibody (HRP)3420Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb51195100 ugCD247 antibody (HRP)5130Recombinant Human T-cell surface glycoprotein CD3 zeta chain proteinorb302333100 TestsCD247 antibody (PE)11250orb131848100 ulCD248 antibodyanti Endosialin antibody, anti Tumor endothelial marker 1 antibody, anti CD248 antibody, anti CD164L1 antibody, anti TEM1 antibody6948N-terminal region of human CD248orb311215100 ulCD248 antibody4716KLH Conjugated synthetic peptideorb338296100 ulCD248 antibody3798A synthesized peptide derived from human CD248orb33829650 ulCD248 antibody3258A synthesized peptide derived from human CD248orb215240200 ulCD248 antibodyanti CD164L1 antibody, anti TEM1 antibody, anti Endosialin antibody, anti Tumor endothelial marker 1 antibody, anti CD248 antibody4410orb215240100 ulCD248 antibodyanti CD164L1 antibody, anti TEM1 antibody, anti Endosialin antibody, anti Tumor endothelial marker 1 antibody, anti CD248 antibody2970orb318850200 ulCD248 antibodyanti CD164L1 antibody, anti TEM1 antibody, anti Endosialin antibody, anti Tumor endothelial marker 1 antibody, anti CD248 antibody4320orb318850100 ulCD248 antibodyanti CD164L1 antibody, anti TEM1 antibody, anti Endosialin antibody, anti Tumor endothelial marker 1 antibody, anti CD248 antibody3060orb36975400 ulCD248 antibodyAnti-Endosialin antibody, anti-Tumor endothelial marker 1 antibody, anti-CD_antigen=CD248 antibody, anti-Flags: Precursor antibody, anti-TEM1 antibody, anti-CD164L1 antibody, anti-CD248 antibody4050Immunogen is CD248 (C-term).orb311544100 ulCD249 antibody4716KLH Conjugated synthetic peptideorb440710.1 mgCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3690orb441550.1 mgCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3690orb448360.1 mgCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3870orb448370.1 mgCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3600orb3021421 mlCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody12240orb76260100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4140A synthetic peptide corresponding to a sequence at the N-terminus of human IL2RA(39-57aa MAYKEGTMLNCECKRGFRR).orb178372100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3600Internal regionorb198037100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3600CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activated human T-lymphocytes.orb348865100 ugCD25 antibody3870Recombinant proteinorb348866100 ugCD25 antibody3870Recombinant proteinorb348908100 ugCD25 antibody3870Recombinant proteinorb389314100 ugCD25 antibody3330orb389314200 ugCD25 antibody4500orb12011100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody2700orb12011500 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody5040orb153477100 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3960Purified recombinant fragment of human IL2RA expressed in E. Coli.orb253278100 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4716KLH conjugated synthetic peptideorb254809100 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4716KLH conjugated synthetic peptideorb380401100 ulCD25 antibody4716orb229267100 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3798A synthetic peptide of human CD25orb22926720 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody2736A synthetic peptide of human CD25orb22926750 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3258A synthetic peptide of human CD25orb44159100 testsCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody5670orb31711120 ugCD25 antibodyanti CD25 antibody antibody3960Stimulated human leukocytes were used as the immunogen for the CD25 antibody.orb317111100 ugCD25 antibodyanti CD25 antibody antibody5850Stimulated human leukocytes were used as the immunogen for the CD25 antibody.orb31711220 ugCD25 antibodyanti CD25 antibody antibody3960Recombinant human protein was used as the immunogen for the CD25 antibody.orb317112100 ugCD25 antibodyanti CD25 antibody antibody5850Recombinant human protein was used as the immunogen for the CD25 antibody.orb308295200 ugCD25 antibodyanti CD25 antibody, anti IL-2R antibody3780PHA activated T cellsorb308297200 ugCD25 antibodyanti CD25 antibody, anti IL-2R antibody3780PHA activated T cellsorb308299200 ugCD25 antibodyanti CD25 antibody, anti IL-2R antibody3780PHA activated T cellsorb361761200 ugCD25 antibody6030Recombinant human CD25/IL2RA Protein orb36176150 ugCD25 antibody3420Recombinant human CD25/IL2RA Protein orb361761100 ugCD25 antibody4680Recombinant human CD25/IL2RA Protein orb256622200 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD25. The exact sequence is proprietary.orb256622100 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD25. The exact sequence is proprietary.orb248904200 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody5220orb24890450 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3150orb248904100 ulCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3600orb308298200 TestsCD25 antibodyanti CD25 antibody, anti IL-2R antibody3780PHA activated T cellsorb231469400 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6030orb231469100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3420orb231469200 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4680orb232123400 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6030orb232123100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3420orb232123200 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4680orb10310100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody2970Synthetic peptide (please contact us for details)orb10310200 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3870Synthetic peptide (please contact us for details)orb23004550 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4050orb230045100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6030orb23146850 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody4050orb231468100 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6030orb36103050 ugCD25 antibody4050Recombinant mouse CD25/IL2RA Protein orb361030100 ugCD25 antibody6030Recombinant mouse CD25/IL2RA Protein orb36120450 ugCD25 antibody4050Recombinant mouse CD25/IL2RA Protein orb361204100 ugCD25 antibody6030Recombinant mouse CD25/IL2RA Protein orb95850500 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6660orb22600500 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3996Con A-activated human cellsorb226001 mgCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6840Con A-activated human cellsorb22680500 ugCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody3996Con A-activated cells.orb226801 mgCD25 antibodyanti CD25 antibody, anti CD 25 antibody, anti IL 2 receptor subunit alpha antibody, anti IL 2R subunit alpha antibody, anti IL-2 receptor subunit alpha antibody, anti IL2 RA antibody, anti IL2 Receptor alpha antibody, anti IL2-RA antibody, anti IL2R alpha chain antibody, anti IL2R antibody, anti IL2R subunit alpha antibody, anti IL2RA antibody, anti Interleukin 2 receptor alpha chain antibody, anti interleukin 2 receptor subunit alpha antibody, anti T Cell Growth Factor Receptor antibody, anti TAC antigen antibody, anti TCGFR antibody6840Con A-activated cells.orb111555100 ulCD25 antibody (Alexa 488)CD 252 antibody (Alexa 488), CD134 ligand antibody (Alexa 488), CD134L antibody (Alexa 488), CD25 antibody (Alexa 488), CD252gen antibody (Alexa 488), glycoprotein 34 kd antibody (Alexa 488), glycoprotein Gp34 antibody (Alexa 488), GP34 antibody (Alexa 488), OX40gen ligand antibody (Alexa 488), OX40 ligand antibody (Alexa 488), OX-40L antibody (Alexa 488)3870Synthetic peptide (Please contact us for more details)orb111063100 ulCD25 antibody (Alexa Fluor 350)CD 252 antibody (Alexa Fluor 350), CD134 ligand antibody (Alexa Fluor 350), CD134L antibody (Alexa Fluor 350), CD25 antibody (Alexa Fluor 350), CD252gen antibody (Alexa Fluor 350), glycoprotein 34 kd antibody (Alexa Fluor 350), glycoprotein Gp34 antibody (Alexa Fluor 350), GP34 antibody (Alexa Fluor 350), OX40gen ligand antibody (Alexa Fluor 350), OX40 ligand antibody (Alexa Fluor 350), OX-40L antibody (Alexa Fluor 350)3870Synthetic peptide (Please contact us for more details)orb113524100 ulCD25 antibody (Alkaline Phosphatase)anti CD25 antibody (Alkaline Phosphatase), anti CD 25 antibody (Alkaline Phosphatase), anti IL 2 receptor subunit alpha antibody (Alkaline Phosphatase), anti IL 2R subunit alpha antibody (Alkaline Phosphatase), anti IL-2 receptor subunit alpha antibody (Alkaline Phosphatase), anti IL2 RA antibody (Alkaline Phosphatase), anti IL2 Receptor alpha antibody (Alkaline Phosphatase), anti IL2-RA antibody (Alkaline Phosphatase), anti IL2R alpha chain antibody (Alkaline Phosphatase), anti IL2R antibody (Alkaline Phosphatase), anti IL2R subunit alpha antibody (Alkaline Phosphatase), anti IL2RA antibody (Alkaline Phosphatase), anti Interleukin 2 receptor alpha chain antibody (Alkaline Phosphatase), anti interleukin 2 receptor subunit alpha antibody (Alkaline Phosphatase), anti T Cell Growth Factor Receptor antibody (Alkaline Phosphatase), anti TAC antigen antibody (Alkaline Phosphatase), anti TCGFR antibody (Alkaline Phosphatase)3870Synthetic peptide (Please contact us for more details)orb1798700.1 mgCD25 antibody (APC)anti CD25 antibody (APC), anti CD 25 antibody (APC), anti IL 2 receptor subunit alpha antibody (APC), anti IL 2R subunit alpha antibody (APC), anti IL-2 receptor subunit alpha antibody (APC), anti IL2 RA antibody (APC), anti IL2 Receptor alpha antibody (APC), anti IL2-RA antibody (APC), anti IL2R alpha chain antibody (APC), anti IL2R antibody (APC), anti IL2R subunit alpha antibody (APC), anti IL2RA antibody (APC), anti Interleukin 2 receptor alpha chain antibody (APC), anti interleukin 2 receptor subunit alpha antibody (APC), anti T Cell Growth Factor Receptor antibody (APC), anti TAC antigen antibody (APC), anti TCGFR antibody (APC)5670B6.1 CTL cell lineorb198253100 TestsCD25 antibody (APC)anti CD25 antibody (APC), anti CD 25 antibody (APC), anti IL 2 receptor subunit alpha antibody (APC), anti IL 2R subunit alpha antibody (APC), anti IL-2 receptor subunit alpha antibody (APC), anti IL2 RA antibody (APC), anti IL2 Receptor alpha antibody (APC), anti IL2-RA antibody (APC), anti IL2R alpha chain antibody (APC), anti IL2R antibody (APC), anti IL2R subunit alpha antibody (APC), anti IL2RA antibody (APC), anti Interleukin 2 receptor alpha chain antibody (APC), anti interleukin 2 receptor subunit alpha antibody (APC), anti T Cell Growth Factor Receptor antibody (APC), anti TAC antigen antibody (APC), anti TCGFR antibody (APC)5670CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activated human T-lymphocytes.orb36251150 TestCD25 antibody (APC)4050orb362511100 TestCD25 antibody (APC)6030orb23146050 TestsCD25 antibody (APC)anti CD25 antibody (APC), anti CD 25 antibody (APC), anti IL 2 receptor subunit alpha antibody (APC), anti IL 2R subunit alpha antibody (APC), anti IL-2 receptor subunit alpha antibody (APC), anti IL2 RA antibody (APC), anti IL2 Receptor alpha antibody (APC), anti IL2-RA antibody (APC), anti IL2R alpha chain antibody (APC), anti IL2R antibody (APC), anti IL2R subunit alpha antibody (APC), anti IL2RA antibody (APC), anti Interleukin 2 receptor alpha chain antibody (APC), anti interleukin 2 receptor subunit alpha antibody (APC), anti T Cell Growth Factor Receptor antibody (APC), anti TAC antigen antibody (APC), anti TCGFR antibody (APC)4050orb231460100 TestsCD25 antibody (APC)anti CD25 antibody (APC), anti CD 25 antibody (APC), anti IL 2 receptor subunit alpha antibody (APC), anti IL 2R subunit alpha antibody (APC), anti IL-2 receptor subunit alpha antibody (APC), anti IL2 RA antibody (APC), anti IL2 Receptor alpha antibody (APC), anti IL2-RA antibody (APC), anti IL2R alpha chain antibody (APC), anti IL2R antibody (APC), anti IL2R subunit alpha antibody (APC), anti IL2RA antibody (APC), anti Interleukin 2 receptor alpha chain antibody (APC), anti interleukin 2 receptor subunit alpha antibody (APC), anti T Cell Growth Factor Receptor antibody (APC), anti TAC antigen antibody (APC), anti TCGFR antibody (APC)6030orb23146450 TestsCD25 antibody (APC)anti CD25 antibody (APC), anti CD 25 antibody (APC), anti IL 2 receptor subunit alpha antibody (APC), anti IL 2R subunit alpha antibody (APC), anti IL-2 receptor subunit alpha antibody (APC), anti IL2 RA antibody (APC), anti IL2 Receptor alpha antibody (APC), anti IL2-RA antibody (APC), anti IL2R alpha chain antibody (APC), anti IL2R antibody (APC), anti IL2R subunit alpha antibody (APC), anti IL2RA antibody (APC), anti Interleukin 2 receptor alpha chain antibody (APC), anti interleukin 2 receptor subunit alpha antibody (APC), anti T Cell Growth Factor Receptor antibody (APC), anti TAC antigen antibody (APC), anti TCGFR antibody (APC)4050orb231464100 TestsCD25 antibody (APC)anti CD25 antibody (APC), anti CD 25 antibody (APC), anti IL 2 receptor subunit alpha antibody (APC), anti IL 2R subunit alpha antibody (APC), anti IL-2 receptor subunit alpha antibody (APC), anti IL2 RA antibody (APC), anti IL2 Receptor alpha antibody (APC), anti IL2-RA antibody (APC), anti IL2R alpha chain antibody (APC), anti IL2R antibody (APC), anti IL2R subunit alpha antibody (APC), anti IL2RA antibody (APC), anti Interleukin 2 receptor alpha chain antibody (APC), anti interleukin 2 receptor subunit alpha antibody (APC), anti T Cell Growth Factor Receptor antibody (APC), anti TAC antigen antibody (APC), anti TCGFR antibody (APC)6030orb440720.1 mgCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)4770orb441560.1 mgCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)4770orb1698290.5 mgCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)5202Con A-activated human T cells.orb1698291 mgCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)7020Con A-activated human T cells.orb12016100 ugCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)2970orb12016500 ugCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)6570orb114017100 ulCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)3870Synthetic peptide (Please contact us for more details)orb198094100 TestsCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)4140CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activated human T-lymphocytes.orb308296100 TestsCD25 antibody (Biotin)anti CD25 antibody, anti IL-2R antibody3780PHA activated T cellsorb24869950 AssaysCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)3600orb248699100 AssaysCD25 antibody (Biotin)anti CD25 antibody (Biotin), anti CD 25 antibody (Biotin), anti IL 2 receptor subunit alpha antibody (Biotin), anti IL 2R subunit alpha antibody (Biotin), anti IL-2 receptor subunit alpha antibody (Biotin), anti IL2 RA antibody (Biotin), anti IL2 Receptor alpha antibody (Biotin), anti IL2-RA antibody (Biotin), anti IL2R alpha chain antibody (Biotin), anti IL2R antibody (Biotin), anti IL2R subunit alpha antibody (Biotin), anti IL2RA antibody (Biotin), anti Interleukin 2 receptor alpha chain antibody (Biotin), anti interleukin 2 receptor subunit alpha antibody (Biotin), anti T Cell Growth Factor Receptor antibody (Biotin), anti TAC antigen antibody (Biotin), anti TCGFR antibody (Biotin)4770orb114509100 ulCD25 antibody (Cy3)anti CD25 antibody (Cy3), anti CD 25 antibody (Cy3), anti IL 2 receptor subunit alpha antibody (Cy3), anti IL 2R subunit alpha antibody (Cy3), anti IL-2 receptor subunit alpha antibody (Cy3), anti IL2 RA antibody (Cy3), anti IL2 Receptor alpha antibody (Cy3), anti IL2-RA antibody (Cy3), anti IL2R alpha chain antibody (Cy3), anti IL2R antibody (Cy3), anti IL2R subunit alpha antibody (Cy3), anti IL2RA antibody (Cy3), anti Interleukin 2 receptor alpha chain antibody (Cy3), anti interleukin 2 receptor subunit alpha antibody (Cy3), anti T Cell Growth Factor Receptor antibody (Cy3), anti TAC antigen antibody (Cy3), anti TCGFR antibody (Cy3)3870Synthetic peptide (Please contact us for more details)orb122459100 ulCD25 antibody (Cy5)anti CD25 antibody (Cy5), anti CD 25 antibody (Cy5), anti IL 2 receptor subunit alpha antibody (Cy5), anti IL 2R subunit alpha antibody (Cy5), anti IL-2 receptor subunit alpha antibody (Cy5), anti IL2 RA antibody (Cy5), anti IL2 Receptor alpha antibody (Cy5), anti IL2-RA antibody (Cy5), anti IL2R alpha chain antibody (Cy5), anti IL2R antibody (Cy5), anti IL2R subunit alpha antibody (Cy5), anti IL2RA antibody (Cy5), anti Interleukin 2 receptor alpha chain antibody (Cy5), anti interleukin 2 receptor subunit alpha antibody (Cy5), anti T Cell Growth Factor Receptor antibody (Cy5), anti TAC antigen antibody (Cy5), anti TCGFR antibody (Cy5)3870Synthetic peptide (Please contact us for more details)orb123042100 ulCD25 antibody (Cy5.5)anti CD25 antibody (Cy5.5), anti CD 25 antibody (Cy5.5), anti IL 2 receptor subunit alpha antibody (Cy5.5), anti IL 2R subunit alpha antibody (Cy5.5), anti IL-2 receptor subunit alpha antibody (Cy5.5), anti IL2 RA antibody (Cy5.5), anti IL2 Receptor alpha antibody (Cy5.5), anti IL2-RA antibody (Cy5.5), anti IL2R alpha chain antibody (Cy5.5), anti IL2R antibody (Cy5.5), anti IL2R subunit alpha antibody (Cy5.5), anti IL2RA antibody (Cy5.5), anti Interleukin 2 receptor alpha chain antibody (Cy5.5), anti interleukin 2 receptor subunit alpha antibody (Cy5.5), anti T Cell Growth Factor Receptor antibody (Cy5.5), anti TAC antigen antibody (Cy5.5), anti TCGFR antibody (Cy5.5)3870Synthetic peptide (Please contact us for more details)orb123534100 ulCD25 antibody (Cy7)anti CD25 antibody (Cy7), anti CD 25 antibody (Cy7), anti IL 2 receptor subunit alpha antibody (Cy7), anti IL 2R subunit alpha antibody (Cy7), anti IL-2 receptor subunit alpha antibody (Cy7), anti IL2 RA antibody (Cy7), anti IL2 Receptor alpha antibody (Cy7), anti IL2-RA antibody (Cy7), anti IL2R alpha chain antibody (Cy7), anti IL2R antibody (Cy7), anti IL2R subunit alpha antibody (Cy7), anti IL2RA antibody (Cy7), anti Interleukin 2 receptor alpha chain antibody (Cy7), anti interleukin 2 receptor subunit alpha antibody (Cy7), anti T Cell Growth Factor Receptor antibody (Cy7), anti TAC antigen antibody (Cy7), anti TCGFR antibody (Cy7)3870Synthetic peptide (Please contact us for more details)orb448380.1 mgCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)3870orb1698300.5 mgCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)5202Con A-activated human T cells.orb1698301 mgCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)7020Con A-activated human T cells.orb3019060.5 mlCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)6480orb44157100 testsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)4770orb198093100 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)4140CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activated human T-lymphocytes.orb308677100 TestsCD25 antibody (FITC)anti CD25 antibody, anti IL-2R antibody3780PHA activated T cellsorb24874450 AssaysCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)3600orb248744100 AssaysCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)4770orb1201250 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)2970orb12012100 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)3870orb17113050 TestsCD25 antibody (FITC)anti IL-2RA antibody4050Recombinant Human CD25/IL-2RA protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD25/IL-2RAorb171130100 TestsCD25 antibody (FITC)anti IL-2RA antibody6030Recombinant Human CD25/IL-2RA protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD25/IL-2RAorb23146250 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)4050orb231462100 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)6030orb23146650 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)4050orb231466100 TestsCD25 antibody (FITC)anti CD25 antibody (FITC), anti CD 25 antibody (FITC), anti IL 2 receptor subunit alpha antibody (FITC), anti IL 2R subunit alpha antibody (FITC), anti IL-2 receptor subunit alpha antibody (FITC), anti IL2 RA antibody (FITC), anti IL2 Receptor alpha antibody (FITC), anti IL2-RA antibody (FITC), anti IL2R alpha chain antibody (FITC), anti IL2R antibody (FITC), anti IL2R subunit alpha antibody (FITC), anti IL2RA antibody (FITC), anti Interleukin 2 receptor alpha chain antibody (FITC), anti interleukin 2 receptor subunit alpha antibody (FITC), anti T Cell Growth Factor Receptor antibody (FITC), anti TAC antigen antibody (FITC), anti TCGFR antibody (FITC)6030orb19528720 TestsCD25 antibody (FITC/PE)anti CD25 antibody (FITC/PE), anti CD 25 antibody (FITC/PE), anti IL 2 receptor subunit alpha antibody (FITC/PE), anti IL 2R subunit alpha antibody (FITC/PE), anti IL-2 receptor subunit alpha antibody (FITC/PE), anti IL2 RA antibody (FITC/PE), anti IL2 Receptor alpha antibody (FITC/PE), anti IL2-RA antibody (FITC/PE), anti IL2R alpha chain antibody (FITC/PE), anti IL2R antibody (FITC/PE), anti IL2R subunit alpha antibody (FITC/PE), anti IL2RA antibody (FITC/PE), anti Interleukin 2 receptor alpha chain antibody (FITC/PE), anti interleukin 2 receptor subunit alpha antibody (FITC/PE), anti T Cell Growth Factor Receptor antibody (FITC/PE), anti TAC antigen antibody (FITC/PE), anti TCGFR antibody (FITC/PE)4716orb110077100 ulCD25 antibody (HRP)anti CD25 antibody (HRP), anti CD 25 antibody (HRP), anti IL 2 receptor subunit alpha antibody (HRP), anti IL 2R subunit alpha antibody (HRP), anti IL-2 receptor subunit alpha antibody (HRP), anti IL2 RA antibody (HRP), anti IL2 Receptor alpha antibody (HRP), anti IL2-RA antibody (HRP), anti IL2R alpha chain antibody (HRP), anti IL2R antibody (HRP), anti IL2R subunit alpha antibody (HRP), anti IL2RA antibody (HRP), anti Interleukin 2 receptor alpha chain antibody (HRP), anti interleukin 2 receptor subunit alpha antibody (HRP), anti T Cell Growth Factor Receptor antibody (HRP), anti TAC antigen antibody (HRP), anti TCGFR antibody (HRP)3870Synthetic peptide (Please contact us for more details)orb448390.1 mgCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)4410orb3019070.5 mlCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)7380orb124518100 ulCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)3870Synthetic peptide (Please contact us for more details)orb44158100 testsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)5670orb179869100 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)6300PHA-activated peripheral blood leucocytesorb198145100 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)4590CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activated human T-lymphocytes.orb308676100 TestsCD25 antibody (PE)anti CD25 antibody, anti IL-2R antibody4230PHA activated T cellsorb24881650 AssaysCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)4050orb248816100 AssaysCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)5940orb36125550 TestCD25 antibody (PE)4050orb361255100 TestCD25 antibody (PE)6030orb1201350 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)2970orb12013100 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)4050orb23146350 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)4050orb231463100 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)6030orb23146750 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)4050orb231467100 TestsCD25 antibody (PE)anti CD25 antibody (PE), anti CD 25 antibody (PE), anti IL 2 receptor subunit alpha antibody (PE), anti IL 2R subunit alpha antibody (PE), anti IL-2 receptor subunit alpha antibody (PE), anti IL2 RA antibody (PE), anti IL2 Receptor alpha antibody (PE), anti IL2-RA antibody (PE), anti IL2R alpha chain antibody (PE), anti IL2R antibody (PE), anti IL2R subunit alpha antibody (PE), anti IL2RA antibody (PE), anti Interleukin 2 receptor alpha chain antibody (PE), anti interleukin 2 receptor subunit alpha antibody (PE), anti T Cell Growth Factor Receptor antibody (PE), anti TAC antigen antibody (PE), anti TCGFR antibody (PE)6030orb125295100 ulCD25 antibody (PE-Cy3)anti CD25 antibody (PE-Cy3), anti CD 25 antibody (PE-Cy3), anti IL 2 receptor subunit alpha antibody (PE-Cy3), anti IL 2R subunit alpha antibody (PE-Cy3), anti IL-2 receptor subunit alpha antibody (PE-Cy3), anti IL2 RA antibody (PE-Cy3), anti IL2 Receptor alpha antibody (PE-Cy3), anti IL2-RA antibody (PE-Cy3), anti IL2R alpha chain antibody (PE-Cy3), anti IL2R antibody (PE-Cy3), anti IL2R subunit alpha antibody (PE-Cy3), anti IL2RA antibody (PE-Cy3), anti Interleukin 2 receptor alpha chain antibody (PE-Cy3), anti interleukin 2 receptor subunit alpha antibody (PE-Cy3), anti T Cell Growth Factor Receptor antibody (PE-Cy3), anti TAC antigen antibody (PE-Cy3), anti TCGFR antibody (PE-Cy3)3870Synthetic peptide (Please contact us for more details)orb129797100 ulCD25 antibody (PE-Cy5)anti CD25 antibody (PE-Cy5), anti CD 25 antibody (PE-Cy5), anti IL 2 receptor subunit alpha antibody (PE-Cy5), anti IL 2R subunit alpha antibody (PE-Cy5), anti IL-2 receptor subunit alpha antibody (PE-Cy5), anti IL2 RA antibody (PE-Cy5), anti IL2 Receptor alpha antibody (PE-Cy5), anti IL2-RA antibody (PE-Cy5), anti IL2R alpha chain antibody (PE-Cy5), anti IL2R antibody (PE-Cy5), anti IL2R subunit alpha antibody (PE-Cy5), anti IL2RA antibody (PE-Cy5), anti Interleukin 2 receptor alpha chain antibody (PE-Cy5), anti interleukin 2 receptor subunit alpha antibody (PE-Cy5), anti T Cell Growth Factor Receptor antibody (PE-Cy5), anti TAC antigen antibody (PE-Cy5), anti TCGFR antibody (PE-Cy5)3870Synthetic peptide (Please contact us for more details)orb24886650 AssaysCD25 antibody (PE-Cy5)anti CD25 antibody (PE-Cy5), anti CD 25 antibody (PE-Cy5), anti IL 2 receptor subunit alpha antibody (PE-Cy5), anti IL 2R subunit alpha antibody (PE-Cy5), anti IL-2 receptor subunit alpha antibody (PE-Cy5), anti IL2 RA antibody (PE-Cy5), anti IL2 Receptor alpha antibody (PE-Cy5), anti IL2-RA antibody (PE-Cy5), anti IL2R alpha chain antibody (PE-Cy5), anti IL2R antibody (PE-Cy5), anti IL2R subunit alpha antibody (PE-Cy5), anti IL2RA antibody (PE-Cy5), anti Interleukin 2 receptor alpha chain antibody (PE-Cy5), anti interleukin 2 receptor subunit alpha antibody (PE-Cy5), anti T Cell Growth Factor Receptor antibody (PE-Cy5), anti TAC antigen antibody (PE-Cy5), anti TCGFR antibody (PE-Cy5)4050orb248866100 AssaysCD25 antibody (PE-Cy5)anti CD25 antibody (PE-Cy5), anti CD 25 antibody (PE-Cy5), anti IL 2 receptor subunit alpha antibody (PE-Cy5), anti IL 2R subunit alpha antibody (PE-Cy5), anti IL-2 receptor subunit alpha antibody (PE-Cy5), anti IL2 RA antibody (PE-Cy5), anti IL2 Receptor alpha antibody (PE-Cy5), anti IL2-RA antibody (PE-Cy5), anti IL2R alpha chain antibody (PE-Cy5), anti IL2R antibody (PE-Cy5), anti IL2R subunit alpha antibody (PE-Cy5), anti IL2RA antibody (PE-Cy5), anti Interleukin 2 receptor alpha chain antibody (PE-Cy5), anti interleukin 2 receptor subunit alpha antibody (PE-Cy5), anti T Cell Growth Factor Receptor antibody (PE-Cy5), anti TAC antigen antibody (PE-Cy5), anti TCGFR antibody (PE-Cy5)5940orb1201450 TestsCD25 antibody (PE-CY5)anti CD25 antibody (PE-Cy5), anti CD 25 antibody (PE-Cy5), anti IL 2 receptor subunit alpha antibody (PE-Cy5), anti IL 2R subunit alpha antibody (PE-Cy5), anti IL-2 receptor subunit alpha antibody (PE-Cy5), anti IL2 RA antibody (PE-Cy5), anti IL2 Receptor alpha antibody (PE-Cy5), anti IL2-RA antibody (PE-Cy5), anti IL2R alpha chain antibody (PE-Cy5), anti IL2R antibody (PE-Cy5), anti IL2R subunit alpha antibody (PE-Cy5), anti IL2RA antibody (PE-Cy5), anti Interleukin 2 receptor alpha chain antibody (PE-Cy5), anti interleukin 2 receptor subunit alpha antibody (PE-Cy5), anti T Cell Growth Factor Receptor antibody (PE-Cy5), anti TAC antigen antibody (PE-Cy5), anti TCGFR antibody (PE-Cy5)3330orb12014100 TestsCD25 antibody (PE-CY5)anti CD25 antibody (PE-Cy5), anti CD 25 antibody (PE-Cy5), anti IL 2 receptor subunit alpha antibody (PE-Cy5), anti IL 2R subunit alpha antibody (PE-Cy5), anti IL-2 receptor subunit alpha antibody (PE-Cy5), anti IL2 RA antibody (PE-Cy5), anti IL2 Receptor alpha antibody (PE-Cy5), anti IL2-RA antibody (PE-Cy5), anti IL2R alpha chain antibody (PE-Cy5), anti IL2R antibody (PE-Cy5), anti IL2R subunit alpha antibody (PE-Cy5), anti IL2RA antibody (PE-Cy5), anti Interleukin 2 receptor alpha chain antibody (PE-Cy5), anti interleukin 2 receptor subunit alpha antibody (PE-Cy5), anti T Cell Growth Factor Receptor antibody (PE-Cy5), anti TAC antigen antibody (PE-Cy5), anti TCGFR antibody (PE-Cy5)4410orb130289100 ulCD25 antibody (PE-Cy5.5)anti CD25 antibody (PE-Cy5.5), anti CD 25 antibody (PE-Cy5.5), anti IL 2 receptor subunit alpha antibody (PE-Cy5.5), anti IL 2R subunit alpha antibody (PE-Cy5.5), anti IL-2 receptor subunit alpha antibody (PE-Cy5.5), anti IL2 RA antibody (PE-Cy5.5), anti IL2 Receptor alpha antibody (PE-Cy5.5), anti IL2-RA antibody (PE-Cy5.5), anti IL2R alpha chain antibody (PE-Cy5.5), anti IL2R antibody (PE-Cy5.5), anti IL2R subunit alpha antibody (PE-Cy5.5), anti IL2RA antibody (PE-Cy5.5), anti Interleukin 2 receptor alpha chain antibody (PE-Cy5.5), anti interleukin 2 receptor subunit alpha antibody (PE-Cy5.5), anti T Cell Growth Factor Receptor antibody (PE-Cy5.5), anti TAC antigen antibody (PE-Cy5.5), anti TCGFR antibody (PE-Cy5.5)3870Synthetic peptide (Please contact us for more details)orb130781100 ulCD25 antibody (PE-Cy7)anti CD25 antibody (PE-Cy7), anti CD 25 antibody (PE-Cy7), anti IL 2 receptor subunit alpha antibody (PE-Cy7), anti IL 2R subunit alpha antibody (PE-Cy7), anti IL-2 receptor subunit alpha antibody (PE-Cy7), anti IL2 RA antibody (PE-Cy7), anti IL2 Receptor alpha antibody (PE-Cy7), anti IL2-RA antibody (PE-Cy7), anti IL2R alpha chain antibody (PE-Cy7), anti IL2R antibody (PE-Cy7), anti IL2R subunit alpha antibody (PE-Cy7), anti IL2RA antibody (PE-Cy7), anti Interleukin 2 receptor alpha chain antibody (PE-Cy7), anti interleukin 2 receptor subunit alpha antibody (PE-Cy7), anti T Cell Growth Factor Receptor antibody (PE-Cy7), anti TAC antigen antibody (PE-Cy7), anti TCGFR antibody (PE-Cy7)3870Synthetic peptide (Please contact us for more details)orb154535100 TestsCD25 antibody (PerCP)anti CD25 antibody (PerCP), anti CD 25 antibody (PerCP), anti IL 2 receptor subunit alpha antibody (PerCP), anti IL 2R subunit alpha antibody (PerCP), anti IL-2 receptor subunit alpha antibody (PerCP), anti IL2 RA antibody (PerCP), anti IL2 Receptor alpha antibody (PerCP), anti IL2-RA antibody (PerCP), anti IL2R alpha chain antibody (PerCP), anti IL2R antibody (PerCP), anti IL2R subunit alpha antibody (PerCP), anti IL2RA antibody (PerCP), anti Interleukin 2 receptor alpha chain antibody (PerCP), anti interleukin 2 receptor subunit alpha antibody (PerCP), anti T Cell Growth Factor Receptor antibody (PerCP), anti TAC antigen antibody (PerCP), anti TCGFR antibody (PerCP)5670PHA-activated peripheral blood leucocytesorb23146150 TestsCD25 antibody (PerCP)anti CD25 antibody (PerCP), anti CD 25 antibody (PerCP), anti IL 2 receptor subunit alpha antibody (PerCP), anti IL 2R subunit alpha antibody (PerCP), anti IL-2 receptor subunit alpha antibody (PerCP), anti IL2 RA antibody (PerCP), anti IL2 Receptor alpha antibody (PerCP), anti IL2-RA antibody (PerCP), anti IL2R alpha chain antibody (PerCP), anti IL2R antibody (PerCP), anti IL2R subunit alpha antibody (PerCP), anti IL2RA antibody (PerCP), anti Interleukin 2 receptor alpha chain antibody (PerCP), anti interleukin 2 receptor subunit alpha antibody (PerCP), anti T Cell Growth Factor Receptor antibody (PerCP), anti TAC antigen antibody (PerCP), anti TCGFR antibody (PerCP)4050orb231461100 TestsCD25 antibody (PerCP)anti CD25 antibody (PerCP), anti CD 25 antibody (PerCP), anti IL 2 receptor subunit alpha antibody (PerCP), anti IL 2R subunit alpha antibody (PerCP), anti IL-2 receptor subunit alpha antibody (PerCP), anti IL2 RA antibody (PerCP), anti IL2 Receptor alpha antibody (PerCP), anti IL2-RA antibody (PerCP), anti IL2R alpha chain antibody (PerCP), anti IL2R antibody (PerCP), anti IL2R subunit alpha antibody (PerCP), anti IL2RA antibody (PerCP), anti Interleukin 2 receptor alpha chain antibody (PerCP), anti interleukin 2 receptor subunit alpha antibody (PerCP), anti T Cell Growth Factor Receptor antibody (PerCP), anti TAC antigen antibody (PerCP), anti TCGFR antibody (PerCP)6030orb23146550 TestsCD25 antibody (PerCP)anti CD25 antibody (PerCP), anti CD 25 antibody (PerCP), anti IL 2 receptor subunit alpha antibody (PerCP), anti IL 2R subunit alpha antibody (PerCP), anti IL-2 receptor subunit alpha antibody (PerCP), anti IL2 RA antibody (PerCP), anti IL2 Receptor alpha antibody (PerCP), anti IL2-RA antibody (PerCP), anti IL2R alpha chain antibody (PerCP), anti IL2R antibody (PerCP), anti IL2R subunit alpha antibody (PerCP), anti IL2RA antibody (PerCP), anti Interleukin 2 receptor alpha chain antibody (PerCP), anti interleukin 2 receptor subunit alpha antibody (PerCP), anti T Cell Growth Factor Receptor antibody (PerCP), anti TAC antigen antibody (PerCP), anti TCGFR antibody (PerCP)4050orb231465100 TestsCD25 antibody (PerCP)anti CD25 antibody (PerCP), anti CD 25 antibody (PerCP), anti IL 2 receptor subunit alpha antibody (PerCP), anti IL 2R subunit alpha antibody (PerCP), anti IL-2 receptor subunit alpha antibody (PerCP), anti IL2 RA antibody (PerCP), anti IL2 Receptor alpha antibody (PerCP), anti IL2-RA antibody (PerCP), anti IL2R alpha chain antibody (PerCP), anti IL2R antibody (PerCP), anti IL2R subunit alpha antibody (PerCP), anti IL2RA antibody (PerCP), anti Interleukin 2 receptor alpha chain antibody (PerCP), anti interleukin 2 receptor subunit alpha antibody (PerCP), anti T Cell Growth Factor Receptor antibody (PerCP), anti TAC antigen antibody (PerCP), anti TCGFR antibody (PerCP)6030orb131273100 ulCD25 antibody (RBITC)anti CD25 antibody (RBITC), anti CD 25 antibody (RBITC), anti IL 2 receptor subunit alpha antibody (RBITC), anti IL 2R subunit alpha antibody (RBITC), anti IL-2 receptor subunit alpha antibody (RBITC), anti IL2 RA antibody (RBITC), anti IL2 Receptor alpha antibody (RBITC), anti IL2-RA antibody (RBITC), anti IL2R alpha chain antibody (RBITC), anti IL2R antibody (RBITC), anti IL2R subunit alpha antibody (RBITC), anti IL2RA antibody (RBITC), anti Interleukin 2 receptor alpha chain antibody (RBITC), anti interleukin 2 receptor subunit alpha antibody (RBITC), anti T Cell Growth Factor Receptor antibody (RBITC), anti TAC antigen antibody (RBITC), anti TCGFR antibody (RBITC)3870Synthetic peptide (Please contact us for more details)orb3019080.5 mlCD25 antibody (TRITC)anti CD25 antibody (TRITC), anti CD 25 antibody (TRITC), anti IL 2 receptor subunit alpha antibody (TRITC), anti IL 2R subunit alpha antibody (TRITC), anti IL-2 receptor subunit alpha antibody (TRITC), anti IL2 RA antibody (TRITC), anti IL2 Receptor alpha antibody (TRITC), anti IL2-RA antibody (TRITC), anti IL2R alpha chain antibody (TRITC), anti IL2R antibody (TRITC), anti IL2R subunit alpha antibody (TRITC), anti IL2RA antibody (TRITC), anti Interleukin 2 receptor alpha chain antibody (TRITC), anti interleukin 2 receptor subunit alpha antibody (TRITC), anti T Cell Growth Factor Receptor antibody (TRITC), anti TAC antigen antibody (TRITC), anti TCGFR antibody (TRITC)8640orb304635200 ulCD252 antibodyanti TXGP1 antibody, anti Tumor necrosis factor ligand superfamily member 4 antibody, anti Glycoprotein Gp34 antibody, anti OX40 ligand antibody, anti OX40L antibody, anti TAX transcriptionally-activated glycoprotein 1 antibody, anti CD252 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD252. The exact sequence is proprietary.orb304635100 ulCD252 antibodyanti TXGP1 antibody, anti Tumor necrosis factor ligand superfamily member 4 antibody, anti Glycoprotein Gp34 antibody, anti OX40 ligand antibody, anti OX40L antibody, anti TAX transcriptionally-activated glycoprotein 1 antibody, anti CD252 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD252. The exact sequence is proprietary.orb304636200 ulCD252 antibodyanti TXGP1 antibody, anti Tumor necrosis factor ligand superfamily member 4 antibody, anti Glycoprotein Gp34 antibody, anti OX40 ligand antibody, anti OX40L antibody, anti TAX transcriptionally-activated glycoprotein 1 antibody, anti CD252 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD252. The exact sequence is proprietary.orb304636100 ulCD252 antibodyanti TXGP1 antibody, anti Tumor necrosis factor ligand superfamily member 4 antibody, anti Glycoprotein Gp34 antibody, anti OX40 ligand antibody, anti OX40L antibody, anti TAX transcriptionally-activated glycoprotein 1 antibody, anti CD252 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD252. The exact sequence is proprietary.orb13723100 ugCD252 antibodyAnti-Tumor necrosis factor ligand superfamily member 4 antibody, anti-glycoprotein 34 kd antibody, anti-glycoprotein Gp34 antibody, anti-GP34 antibody, anti-OX-40L antibody, anti-OX40 antigen ligand antibody, anti-OX40 ligand antibody, anti-OX40L antibody, anti-TAX transcriptionally-activated glycoprotein 1 antibody, anti-CD 252 antibody, anti-CD252 antigen antibody, anti-CD 134L antibody, anti-CD134 ligand antibody, anti-CD134L antibody, anti-TNFSF4 antibody,2970Synthetic peptide (please contact us for details)orb13723200 ugCD252 antibodyAnti-Tumor necrosis factor ligand superfamily member 4 antibody, anti-glycoprotein 34 kd antibody, anti-glycoprotein Gp34 antibody, anti-GP34 antibody, anti-OX-40L antibody, anti-OX40 antigen ligand antibody, anti-OX40 ligand antibody, anti-OX40L antibody, anti-TAX transcriptionally-activated glycoprotein 1 antibody, anti-CD 252 antibody, anti-CD252 antigen antibody, anti-CD 134L antibody, anti-CD134 ligand antibody, anti-CD134L antibody, anti-TNFSF4 antibody,3870Synthetic peptide (please contact us for details)orb14275100 ugCD252 antibody (FITC)Anti-Tumor necrosis factor ligand superfamily member 4 antibody, anti-glycoprotein 34 kd antibody, anti-glycoprotein Gp34 antibody, anti-GP34 antibody, anti-OX-40L antibody, anti-OX40 antigen ligand antibody, anti-OX40 ligand antibody, anti-OX40L antibody, anti-TAX transcriptionally-activated glycoprotein 1 antibody, anti-CD 252 antibody, anti-CD252 antigen antibody, anti-CD 134L antibody, anti-CD134 ligand antibody, anti-CD134L antibody, anti-TNFSF4 antibody,3870Synthetic peptide (please contact us for details)orb2227280.1 mgCD253 antibodyTRAIL4770Recombinant soluble fragment of human TRAIL.orb387903100 ugCD253 antibody3690Recombinant soluble fragment (aa 95-281) of human TRAIL.orb126440100 ugCD253 antibody2880Synthesized peptide derived from internal of human CD253.orb126440200 ugCD253 antibody4140Synthesized peptide derived from internal of human CD253.orb193694100 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody4716Synthesized peptide derived from internal of human CD253.orb225738100 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti CD253 antigen antibody, anti TNFSF10 antibody, anti APO2L antibody, anti TRAIL antibody3798A synthesized peptideorb22573820 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti CD253 antigen antibody, anti TNFSF10 antibody, anti APO2L antibody, anti TRAIL antibody2736A synthesized peptideorb22573850 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti CD253 antigen antibody, anti TNFSF10 antibody, anti APO2L antibody, anti TRAIL antibody3258A synthesized peptideorb227930100 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti CD253 antigen antibody, anti TNFSF10 antibody, anti APO2L antibody, anti TRAIL antibody3798A synthesized peptide derived from human CD253orb22793020 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti CD253 antigen antibody, anti TNFSF10 antibody, anti APO2L antibody, anti TRAIL antibody2736A synthesized peptide derived from human CD253orb22793050 ulCD253 antibodyanti Tumor necrosis factor ligand superfamily member 10 antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti CD253 antigen antibody, anti TNFSF10 antibody, anti APO2L antibody, anti TRAIL antibody3258A synthesized peptide derived from human CD253orb304632200 ulCD253 antibodyanti APO2L antibody, anti TRAIL antibody, anti Tumor necrosis factor ligand superfamily member 10 antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti CD253 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD253. The exact sequence is proprietary.orb304632100 ulCD253 antibodyanti APO2L antibody, anti TRAIL antibody, anti Tumor necrosis factor ligand superfamily member 10 antibody, anti Apo-2 ligand antibody, anti Apo-2L antibody, anti TNF-related apoptosis-inducing ligand antibody, anti Protein TRAIL antibody, anti CD253 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD253. The exact sequence is proprietary.orb1544970.1 mgCD253 antibody (PE )5670Recombinant soluble fragment (aa 95-281) of human TRAIL. orb304633200 ulCD254 antibodyanti OPGL antibody, anti RANKL antibody, anti TRANCE antibody, anti Tumor necrosis factor ligand superfamily member 11 antibody, anti Osteoclast differentiation factor antibody, anti ODF antibody, anti Osteoprotegerin ligand antibody, anti OPGL antibody, anti Receptor activator of nuclear factor kappa-B ligand antibody, anti RANKL antibody, anti TNF-related activation-induced cytokine antibody, anti TRANCE antibody, anti CD254 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD254. The exact sequence is proprietary.orb304633100 ulCD254 antibodyanti OPGL antibody, anti RANKL antibody, anti TRANCE antibody, anti Tumor necrosis factor ligand superfamily member 11 antibody, anti Osteoclast differentiation factor antibody, anti ODF antibody, anti Osteoprotegerin ligand antibody, anti OPGL antibody, anti Receptor activator of nuclear factor kappa-B ligand antibody, anti RANKL antibody, anti TNF-related activation-induced cytokine antibody, anti TRANCE antibody, anti CD254 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD254. The exact sequence is proprietary.orb2227540.1 mgCD255 antibodyTWEAK3690human CD255-transfected 2PK-3 cellsorb2227550.1 mgCD255 antibodyTWEAK3690human CD255-transfected 2PK-3 cellsorb248905200 ulCD255 antibodyanti TNFSF12 antibody, anti APO3L antibody, anti DR3LG antibody, anti Tumor necrosis factor ligand superfamily member 12 antibody, anti APO3 ligand antibody, anti TNF-related weak inducer of apoptosis antibody, anti TWEAK) antibody5220orb24890550 ulCD255 antibodyanti TNFSF12 antibody, anti APO3L antibody, anti DR3LG antibody, anti Tumor necrosis factor ligand superfamily member 12 antibody, anti APO3 ligand antibody, anti TNF-related weak inducer of apoptosis antibody, anti TWEAK) antibody3150orb248905100 ulCD255 antibodyanti TNFSF12 antibody, anti APO3L antibody, anti DR3LG antibody, anti Tumor necrosis factor ligand superfamily member 12 antibody, anti APO3 ligand antibody, anti TNF-related weak inducer of apoptosis antibody, anti TWEAK) antibody3600orb222756100 testsCD255 antibody (PE)TWEAK5670human CD255-transfected 2PK-3 cellsorb339099200 ulCD257 antibodyanti BAFF antibody, anti BLYS antibody, anti TALL1 antibody, anti TNFSF20 antibody, anti ZTNF4 antibody, anti Tumor necrosis factor ligand superfamily member 13B antibody, anti B lymphocyte stimulator antibody, anti BLyS antibody, anti B-cell-activating factor antibody, anti BAFF antibody, anti Dendritic cell-derived TNF-like molecule antibody, anti TNF- and APOL-related leukocyte expressed ligand 1 antibody, anti TALL-1 antibody, anti CD257 antibody4320orb339099100 ulCD257 antibodyanti BAFF antibody, anti BLYS antibody, anti TALL1 antibody, anti TNFSF20 antibody, anti ZTNF4 antibody, anti Tumor necrosis factor ligand superfamily member 13B antibody, anti B lymphocyte stimulator antibody, anti BLyS antibody, anti B-cell-activating factor antibody, anti BAFF antibody, anti Dendritic cell-derived TNF-like molecule antibody, anti TNF- and APOL-related leukocyte expressed ligand 1 antibody, anti TALL-1 antibody, anti CD257 antibody3870orb304634200 ulCD258 antibodyanti HVEML antibody, anti LIGHT antibody, anti Tumor necrosis factor ligand superfamily member 14 antibody, anti Herpes virus entry mediator ligand antibody, anti HVEM-L antibody, anti Herpesvirus entry mediator ligand antibody, anti CD258 antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD258. The exact sequence is proprietary.orb304634100 ulCD258 antibodyanti HVEML antibody, anti LIGHT antibody, anti Tumor necrosis factor ligand superfamily member 14 antibody, anti Herpes virus entry mediator ligand antibody, anti HVEM-L antibody, anti Herpesvirus entry mediator ligand antibody, anti CD258 antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD258. The exact sequence is proprietary.orb446820.1 mgCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody4410orb198038100 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody3600orb234158100 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody9666peptideorb301803100 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody4950orb302683100 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody10080orb19540100 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody4500Peptide with sequence C-PPHFDKSKKYP, from the internal region of the protein sequence according to NP_001926.2.orb13310100 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody2970Synthetic peptide (please contact us for details)orb13310200 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody3870Synthetic peptide (please contact us for details)orb44685100 testsCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody5670orb31696720 ugCD26 antibodyanti CD26 antibody antibody3960A human T cell clone was used as the immunogen for the CD26 antibody.orb316967100 ugCD26 antibodyanti CD26 antibody antibody5850A human T cell clone was used as the immunogen for the CD26 antibody.orb31696820 ugCD26 antibodyanti CD26 antibody antibody3960Recombinant human protein was used as the immunogen for the CD26 antibody.orb316968100 ugCD26 antibodyanti CD26 antibody antibody5850Recombinant human protein was used as the immunogen for the CD26 antibody.orb31696920 ugCD26 antibodyanti CD26 antibody antibody3960A synthetic peptide from the amino terminal region of the human protein was used as the immunogen for the CD26 antibody.orb316969100 ugCD26 antibodyanti CD26 antibody antibody5850A synthetic peptide from the amino terminal region of the human protein was used as the immunogen for the CD26 antibody.orb234799200 ulCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody4410orb234799100 ulCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody2970orb315773200 ulCD26 antibodyanti ADCP2 antibody, anti CD26 antibody, anti Dipeptidyl peptidase 4 antibody, anti ADABP antibody, anti Adenosine deaminase complexing protein 2 antibody, anti ADCP-2 antibody, anti Dipeptidyl peptidase IV antibody, anti DPP IV antibody, anti T-cell activation antigen CD26 antibody, anti TP103 antibody, anti CD26 antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD26. The exact sequence is proprietary.orb315773100 ulCD26 antibodyanti ADCP2 antibody, anti CD26 antibody, anti Dipeptidyl peptidase 4 antibody, anti ADABP antibody, anti Adenosine deaminase complexing protein 2 antibody, anti ADCP-2 antibody, anti Dipeptidyl peptidase IV antibody, anti DPP IV antibody, anti T-cell activation antigen CD26 antibody, anti TP103 antibody, anti CD26 antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD26. The exact sequence is proprietary.orb165000400 ulCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody4050This DPP4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 357-384 amino acids from the Central region of human DPP4.orb166468400 ulCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody4050This DPP4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 46-74 amino acids from the N-terminal region of human DPP4.orb8640850 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody6660Synthetic peptideorb8641050 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody6660Synthetic peptideorb9627750 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody6660Synthetic peptideorb9675950 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody6660Synthetic peptideorb9676050 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody6660Synthetic peptideorb9676150 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody6660Synthetic peptideorb10928550 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody9090N-terminal domain of humanorb10929750 ugCD26 antibodyanti CD26 antigen antibody, anti ADA-binding protein antibody, anti ADABP antibody, anti ADCP 2 antibody, anti ADCP-2 antibody, anti ADCP2 antibody, anti CD 26 antibody, anti CD26 antibody, anti CD26 antigen 3 antibody, anti Dipeptidyl peptidase 4 antibody, anti Dipeptidyl peptidase 4 soluble form antibody, anti Dipeptidyl peptidase iv antibody, anti Dipeptidyl peptidase IV soluble form antibody, anti Dipeptidyl peptidase, intestinal antibody, anti Dipeptidylpeptidase 4 antibody, anti Dipeptidylpeptidase IV antibody, anti DPP 4 antibody, anti DPP IV antibody, anti DPP IV estoenzyme antibody, anti DPP4 antibody, anti DPPIV antibody, anti Intestinal dipeptidyl peptidase antibody, anti T cell activation antigen CD26 antibody, anti TP 103 antibody, anti TP103 antibody9090internal domain of humanorb13855100 ugCD26 antibody (FITC)anti CD26 antigen antibody (FITC), anti ADA-binding protein antibody (FITC), anti ADABP antibody (FITC), anti ADCP 2 antibody (FITC), anti ADCP-2 antibody (FITC), anti ADCP2 antibody (FITC), anti CD 26 antibody (FITC), anti CD26 antibody (FITC), anti CD26 antigen 3 antibody (FITC), anti Dipeptidyl peptidase 4 antibody (FITC), anti Dipeptidyl peptidase 4 soluble form antibody (FITC), anti Dipeptidyl peptidase iv antibody (FITC), anti Dipeptidyl peptidase IV soluble form antibody (FITC), anti Dipeptidyl peptidase, intestinal antibody (FITC), anti Dipeptidylpeptidase 4 antibody (FITC), anti Dipeptidylpeptidase IV antibody (FITC), anti DPP 4 antibody (FITC), anti DPP IV antibody (FITC), anti DPP IV estoenzyme antibody (FITC), anti DPP4 antibody (FITC), anti DPPIV antibody (FITC), anti Intestinal dipeptidyl peptidase antibody (FITC), anti T cell activation antigen CD26 antibody (FITC), anti TP 103 antibody (FITC), anti TP103 antibody (FITC)3870Synthetic peptide (please contact us for details)orb44683100 testsCD26 antibody (FITC)anti CD26 antigen antibody (FITC), anti ADA-binding protein antibody (FITC), anti ADABP antibody (FITC), anti ADCP 2 antibody (FITC), anti ADCP-2 antibody (FITC), anti ADCP2 antibody (FITC), anti CD 26 antibody (FITC), anti CD26 antibody (FITC), anti CD26 antigen 3 antibody (FITC), anti Dipeptidyl peptidase 4 antibody (FITC), anti Dipeptidyl peptidase 4 soluble form antibody (FITC), anti Dipeptidyl peptidase iv antibody (FITC), anti Dipeptidyl peptidase IV soluble form antibody (FITC), anti Dipeptidyl peptidase, intestinal antibody (FITC), anti Dipeptidylpeptidase 4 antibody (FITC), anti Dipeptidylpeptidase IV antibody (FITC), anti DPP 4 antibody (FITC), anti DPP IV antibody (FITC), anti DPP IV estoenzyme antibody (FITC), anti DPP4 antibody (FITC), anti DPPIV antibody (FITC), anti Intestinal dipeptidyl peptidase antibody (FITC), anti T cell activation antigen CD26 antibody (FITC), anti TP 103 antibody (FITC), anti TP103 antibody (FITC)4770orb198095100 TestsCD26 antibody (FITC)anti CD26 antigen antibody (FITC), anti ADA-binding protein antibody (FITC), anti ADABP antibody (FITC), anti ADCP 2 antibody (FITC), anti ADCP-2 antibody (FITC), anti ADCP2 antibody (FITC), anti CD 26 antibody (FITC), anti CD26 antibody (FITC), anti CD26 antigen 3 antibody (FITC), anti Dipeptidyl peptidase 4 antibody (FITC), anti Dipeptidyl peptidase 4 soluble form antibody (FITC), anti Dipeptidyl peptidase iv antibody (FITC), anti Dipeptidyl peptidase IV soluble form antibody (FITC), anti Dipeptidyl peptidase, intestinal antibody (FITC), anti Dipeptidylpeptidase 4 antibody (FITC), anti Dipeptidylpeptidase IV antibody (FITC), anti DPP 4 antibody (FITC), anti DPP IV antibody (FITC), anti DPP IV estoenzyme antibody (FITC), anti DPP4 antibody (FITC), anti DPPIV antibody (FITC), anti Intestinal dipeptidyl peptidase antibody (FITC), anti T cell activation antigen CD26 antibody (FITC), anti TP 103 antibody (FITC), anti TP103 antibody (FITC)4140orb44684100 testsCD26 antibody (PE)anti CD26 antigen antibody (PE), anti ADA-binding protein antibody (PE), anti ADABP antibody (PE), anti ADCP 2 antibody (PE), anti ADCP-2 antibody (PE), anti ADCP2 antibody (PE), anti CD 26 antibody (PE), anti CD26 antibody (PE), anti CD26 antigen 3 antibody (PE), anti Dipeptidyl peptidase 4 antibody (PE), anti Dipeptidyl peptidase 4 soluble form antibody (PE), anti Dipeptidyl peptidase iv antibody (PE), anti Dipeptidyl peptidase IV soluble form antibody (PE), anti Dipeptidyl peptidase, intestinal antibody (PE), anti Dipeptidylpeptidase 4 antibody (PE), anti Dipeptidylpeptidase IV antibody (PE), anti DPP 4 antibody (PE), anti DPP IV antibody (PE), anti DPP IV estoenzyme antibody (PE), anti DPP4 antibody (PE), anti DPPIV antibody (PE), anti Intestinal dipeptidyl peptidase antibody (PE), anti T cell activation antigen CD26 antibody (PE), anti TP 103 antibody (PE), anti TP103 antibody (PE)5670orb198146100 TestsCD26 antibody (PE)anti CD26 antigen antibody (PE), anti ADA-binding protein antibody (PE), anti ADABP antibody (PE), anti ADCP 2 antibody (PE), anti ADCP-2 antibody (PE), anti ADCP2 antibody (PE), anti CD 26 antibody (PE), anti CD26 antibody (PE), anti CD26 antigen 3 antibody (PE), anti Dipeptidyl peptidase 4 antibody (PE), anti Dipeptidyl peptidase 4 soluble form antibody (PE), anti Dipeptidyl peptidase iv antibody (PE), anti Dipeptidyl peptidase IV soluble form antibody (PE), anti Dipeptidyl peptidase, intestinal antibody (PE), anti Dipeptidylpeptidase 4 antibody (PE), anti Dipeptidylpeptidase IV antibody (PE), anti DPP 4 antibody (PE), anti DPP IV antibody (PE), anti DPP IV estoenzyme antibody (PE), anti DPP4 antibody (PE), anti DPPIV antibody (PE), anti Intestinal dipeptidyl peptidase antibody (PE), anti T cell activation antigen CD26 antibody (PE), anti TP 103 antibody (PE), anti TP103 antibody (PE)4590orb1543770.1 mgCD261 antibody4770Fusion protein containing the extracellular part of TRAIL-R1 and the constant part of the heavy chain of the human IgG1. orb1544200.1 mgCD261 antibody4770Fusion protein containing the extracellular part of TRAIL-R1 and the constant part of the heavy chain of the human IgG1. orb2227630.1 mgCD261 antibody (APC)TRAIL-R17560Fusion protein containing the extracellular part of TRAIL-R1 and the constant part of the heavy chain of the human IgG1.orb437550.1 mgCD261 antibody (FITC)Anti-CD261 antibody, anti-DR4 antibody6750orb437560.1 mgCD261 antibody (PE)Anti-CD261 antibody, anti-DR4 antibody7560orb437570.1 mgCD262 antibodyAnti-CD262 antibody4770orb437580.1 mgCD262 antibody (FITC)Anti-CD262 antibody6750orb437590.1 mgCD262 antibody (PE)Anti-CD262 antibody7110orb445200.1 mgCD263 antibodyAnti-CD263 antibody4770orb445210.1 mgCD263 antibody (FITC)Anti-CD263 antibody6750orb445220.1 mgCD263 antibody (PE)Anti-CD263 antibody7470orb445230.1 mgCD264 antibodyAnti-CD264 antibody4770orb315822200 ulCD264 antibodyanti DCR2 antibody, anti TRAILR4 antibody, anti TRUNDD antibody, anti Tumor necrosis factor receptor superfamily member 10D antibody, anti Decoy receptor 2 antibody, anti DcR2 antibody, anti TNF-related apoptosis-inducing ligand receptor 4 antibody, anti TRAIL receptor 4 antibody, anti TRAIL-R4 antibody, anti TRAIL receptor with a truncated death domain antibody, anti CD264 antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD264. The exact sequence is proprietary.orb315822100 ulCD264 antibodyanti DCR2 antibody, anti TRAILR4 antibody, anti TRUNDD antibody, anti Tumor necrosis factor receptor superfamily member 10D antibody, anti Decoy receptor 2 antibody, anti DcR2 antibody, anti TNF-related apoptosis-inducing ligand receptor 4 antibody, anti TRAIL receptor 4 antibody, anti TRAIL-R4 antibody, anti TRAIL receptor with a truncated death domain antibody, anti CD264 antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD264. The exact sequence is proprietary.orb445240.1 mgCD264 antibody (FITC)Anti-CD264 antibody6750orb445250.1 mgCD264 antibody (PE)Anti-CD264 antibody7470orb2227800.1 mgCD266 antibodyTWEAK R3690human CD266-transfected P815 cellsorb2227810.1 mgCD266 antibodyTWEAK R3690human CD266-transfected P815 cellsorb2227820.1 mgCD266 antibody (PE)TWEAK R5670human CD266-transfected P815 cellsorb387894100 ugCD267 antibody3690CD267-transfected RBL cellsorb311537100 ulCD267 antibody4716KLH Conjugated synthetic peptideorb234800200 ulCD268 antibodyanti BAFFR antibody, anti BR3 antibody, anti Tumor necrosis factor receptor superfamily member 13C antibody, anti B-cell-activating factor receptor antibody, anti BAFF receptor antibody, anti BAFF-R antibody, anti BLyS receptor 3 antibody, anti CD268 antibody4410orb234800100 ulCD268 antibodyanti BAFFR antibody, anti BR3 antibody, anti Tumor necrosis factor receptor superfamily member 13C antibody, anti B-cell-activating factor receptor antibody, anti BAFF receptor antibody, anti BAFF-R antibody, anti BLyS receptor 3 antibody, anti CD268 antibody2970orb234801200 ulCD269 antibodyanti BCM antibody, anti BCMA antibody, anti Tumor necrosis factor receptor superfamily member 17 antibody, anti B-cell maturation protein antibody, anti CD269 antibody4410orb234801100 ulCD269 antibodyanti BCM antibody, anti BCMA antibody, anti Tumor necrosis factor receptor superfamily member 17 antibody, anti B-cell maturation protein antibody, anti CD269 antibody2970orb439490.1 mgCD27 antibodyAnti-CD27 antibody3690orb982900.1 mgCD27 antibody5670orb982920.1 mgCD27 antibody5670orb982911 mlCD27 antibody4140orb982931 mlCD27 antibody4140orb3018421 mlCD27 antibodyanti LT27 antibody13230orb195344100 ugCD27 antibodyanti CD27 antibody, anti CD27 molecule antibody, anti S152 antibody, anti S152. LPFS2 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody, anti CD27 antigen antibody, anti CD27L receptor antibody, anti T cell activation antigen S152 antibody, anti T-cell activation antigen CD27 antibody, anti tumor necrosis factor receptor superfamily, member 7 antibody4500Internal region C-QTLADFRQLPARTLS QTLADFRQLPARTLSorb198039100 ugCD27 antibody3600orb301882100 ugCD27 antibody5850orb371665100 ugCD27 antibodyanti-CD 27 antibody, anti-CD27 antibody, anti-CD27 antigen antibody, anti-CD27 molecule antibody, anti-CD27L receptor antibody, anti-LPFS2 antibody, anti-S152 antibody, anti-T14 antibody, anti-TNFRSF 7 antibody, anti-TNFRSF7 antibody, anti-TNFSF7 antibody, anti-Tp 55 antibody, anti-Tp55 antibody, anti-P26842 antibody4860E. coli-derived human CD27 recombinant protein (Position: A20-R191). Human CD27 shares 62.8% amino acid (aa) sequence identity with mouse CD27.orb388882100 ugCD27 antibody4356Sezary cellsorb388883100 ugCD27 antibody4356Recombinant human CD22 protein (exact sequence is proprietary)orb13301100 ugCD27 antibodyanti-CD 27 antibody, anti-CD27 molecule antibody, anti-CD27L receptor antibody, anti-MGC20393 antibody, anti-S152 antibody, anti-T cell activationgen CD27 antibody, anti-T cellvationgen S152 antibody, anti-T14 antibody, anti-TNFRSF7 antibody, anti-Tp55 antibody, anti-Tp55 an antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 7 antibody2970Synthetic peptide (please contact us for details)orb13301200 ugCD27 antibodyanti-CD 27 antibody, anti-CD27 molecule antibody, anti-CD27L receptor antibody, anti-MGC20393 antibody, anti-S152 antibody, anti-T cell activationgen CD27 antibody, anti-T cellvationgen S152 antibody, anti-T14 antibody, anti-TNFRSF7 antibody, anti-Tp55 antibody, anti-Tp55 an antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 7 antibody3870Synthetic peptide (please contact us for details)orb13179100 ulCD27 antibodyanti-CD 27 antibody, anti-CD27 molecule antibody, anti-CD27L receptor antibody, anti-MGC20393 antibody, anti-S152 antibody, anti-T cell activationgen CD27 antibody, anti-T cellvationgen S152 antibody, anti-T14 antibody, anti-TNFRSF7 antibody, anti-Tp55 antibody, anti-Tp55 an antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 7 antibody4230Synthetic peptide (please contact us for details)orb192425100 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody4716Recombinant protein of human CD27.orb331016100 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody5760Synthetic peptide located within the following region: LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSPorb335126100 ulCD27 antibody3798A synthesized peptideorb33512650 ulCD27 antibody3258A synthesized peptideorb228844100 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody, anti antibody3798Recombinant protein of human CD27orb22884420 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody, anti antibody2736Recombinant protein of human CD27orb22884450 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody, anti antibody3258Recombinant protein of human CD27orb43953100 testsCD27 antibodyAnti-CD27 antibody5670orb5622120 ugCD27 antibody3960Sezary cells were used as the immunogen for the CD27 antibody.orb56221100 ugCD27 antibody5850Sezary cells were used as the immunogen for the CD27 antibody.orb5631220 ugCD27 antibody3960Sezary cells were used as the immunogen for the CD27 antibody.orb56312100 ugCD27 antibody5850Sezary cells were used as the immunogen for the CD27 antibody.orb170682200 ugCD27 antibody6030Recombinant Human CD27 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD27orb17068250 ugCD27 antibody3420Recombinant Human CD27 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD27orb170682100 ugCD27 antibody4680Recombinant Human CD27 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD27orb229918200 ugCD27 antibody6030orb22991850 ugCD27 antibody3420orb229918100 ugCD27 antibody4680orb361538200 ugCD27 antibody6030Recombinant human CD27 Protein orb36153850 ugCD27 antibody3420Recombinant human CD27 Protein orb361538100 ugCD27 antibody4680Recombinant human CD27 Protein orb377975200 ulCD27 antibody6210Recombinant full length protein of human CD27orb377975100 ulCD27 antibody4050Recombinant full length protein of human CD27orb229917400 ugCD27 antibody6030orb229917100 ugCD27 antibody3420orb229917200 ugCD27 antibody4680orb31826400 ulCD27 antibodyAnti-CD27 antigen antibody, anti-CD27 antibody, anti-TNFRSF7 antibody4050This CD27 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from the C-terminal region of human CD27.orb9611850 ugCD27 antibody6660orb8868850 ugCD27 antibody6660orb31389250 ugCD27 antibodyanti CD27 antibody, anti CD27 antigen antibody, anti CD27 molecule antibody, anti S152 antibody, anti T14 antibody, anti T-cell activation antigen CD27 antibody, anti CD27L receptor antibody, anti T cell activation antigen S152 antibody, anti TNFRSF7 antibody, anti Tp55 antibody6660orb17023250 ugCD27 antibody4050Recombinant Mouse CD27 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD27orb170232100 ugCD27 antibody6030Recombinant Mouse CD27 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD27orb17059850 ugCD27 antibody4050Recombinant Mouse CD27 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD27orb170598100 ugCD27 antibody6030Recombinant Mouse CD27 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD27orb23139650 ugCD27 antibody4050orb231396100 ugCD27 antibody6030orb35086450 ugCD27 antibodyanti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody3420Recombinant human CD27 antigen proteinorb350864100 ugCD27 antibodyanti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody5130Recombinant human CD27 antigen proteinorb36130950 ugCD27 antibody4050Recombinant human CD27 Protein orb361309100 ugCD27 antibody6030Recombinant human CD27 Protein orb36131050 ugCD27 antibody4050Recombinant human CD27 Protein orb361310100 ugCD27 antibody6030Recombinant human CD27 Protein orb4830750 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody3060Recombinant protein of human CD27orb48307100 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody4140Recombinant protein of human CD27orb48307200 ulCD27 antibodyanti MGC20393 antibody, anti S152 antibody, anti T14 antibody, anti TNFRSF7 antibody, anti Tp55 antibody6480Recombinant protein of human CD27orb22991050 TestsCD27 antibody (APC)4050orb229910100 TestsCD27 antibody (APC)6030orb22991350 TestsCD27 antibody (APC)4050orb229913100 TestsCD27 antibody (APC)6030orb22991550 TestsCD27 antibody (APC)4050orb229915100 TestsCD27 antibody (APC)6030orb23139750 TestsCD27 antibody (APC)4050orb231397100 TestsCD27 antibody (APC)6030orb35086750 ugCD27 antibody (Biotin)anti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody3420Recombinant human CD27 antigen proteinorb350867100 ugCD27 antibody (Biotin)anti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody5130Recombinant human CD27 antigen proteinorb154545100 TestsCD27 antibody (DyLight 594)6300Human peripheral blood lymphocytesorb13856100 ugCD27 antibody (FITC)anti-CD 27 antibody, anti-CD27 molecule antibody, anti-CD27L receptor antibody, anti-MGC20393 antibody, anti-S152 antibody, anti-T cell activationgen CD27 antibody, anti-T cellvationgen S152 antibody, anti-T14 antibody, anti-TNFRSF7 antibody, anti-Tp55 antibody, anti-Tp55 an antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 7 antibody3870Synthetic peptide (please contact us for details)orb43950100 testsCD27 antibody (FITC)Anti-CD27 antibody4770orb198096100 TestsCD27 antibody (FITC)4140orb35086650 ugCD27 antibody (FITC)anti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody3420Recombinant human CD27 antigen proteinorb350866100 ugCD27 antibody (FITC)anti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody5130Recombinant human CD27 antigen proteinorb36274350 TestCD27 antibody (FITC)4050Recombinant human CD27/TNFRSF7 protein orb362743100 TestCD27 antibody (FITC)6030Recombinant human CD27/TNFRSF7 protein orb36274450 TestCD27 antibody (FITC)4050Recombinant human CD27/TNFRSF7 protein orb362744100 TestCD27 antibody (FITC)6030Recombinant human CD27/TNFRSF7 protein orb17037950 TestsCD27 antibody (FITC)anti TNFRSF7 antibody4050Recombinant Mouse CD27 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD27/TNFRSF7orb170379100 TestsCD27 antibody (FITC)anti TNFRSF7 antibody6030Recombinant Mouse CD27 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD27/TNFRSF7orb17089650 TestsCD27 antibody (FITC)anti TNFRSF7 antibody4050Recombinant Human CD27/TNFRSF7 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD27/TNFRSF7orb170896100 TestsCD27 antibody (FITC)anti TNFRSF7 antibody6030Recombinant Human CD27/TNFRSF7 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD27/TNFRSF7orb198275100 TestsCD27 antibody (FITC, PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb19815550 TestsCD27 antibody (FITC, PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb35086550 ugCD27 antibody (HRP)anti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody3420Recombinant human CD27 antigen proteinorb350865100 ugCD27 antibody (HRP)anti-CD27 antigen antibody, anti-CD27L receptor antibody, anti-T-cell activation antigen CD27 antibody, anti-T14 antibody, anti-Tumor necrosis factor receptor superfamily member 7 antibody, anti-CD27 antibody, anti-TNFRSF7 antibody5130Recombinant human CD27 antigen proteinorb43951100 testsCD27 antibody (PE)Anti-CD27 antibody5670orb198147100 TestsCD27 antibody (PE)4590orb301883100 TestsCD27 antibody (PE)8550orb146640100 TestsCD27 antibody (PE)6030orb14664050 TestsCD27 antibody (PE)4050orb146641100 TestsCD27 antibody (PE)6030orb14664150 TestsCD27 antibody (PE)4050orb22991250 TestsCD27 antibody (PE)4050orb229912100 TestsCD27 antibody (PE)6030orb22991150 TestsCD27 antibody (PerCP)4050orb229911100 TestsCD27 antibody (PerCP)6030orb22991450 TestsCD27 antibody (PerCP)4050orb229914100 TestsCD27 antibody (PerCP)6030orb22991650 TestsCD27 antibody (PerCP)4050orb229916100 TestsCD27 antibody (PerCP)6030orb23139850 TestsCD27 antibody (PerCP)4050orb231398100 TestsCD27 antibody (PerCP)6030orb1543820.1 mgCD271 antibody3690Purified CD271 protein isolated from human melanoma cell line A875orb224643100 ulCD271 antibodyanti CD271 antibody, anti Gp80-LNGFR antibody, anti low affinity nerve growth factor receptor antibody, anti Low-affinity nerve growth factor receptor antibody, anti nerve growth factor receptor (TNFR superfamily antibody, anti member 16) antibody, anti NGF receptor antibody, anti NGFR antibody, anti p75 ICD antibody, anti p75(NTR) antibody, anti p75NTR antibody, anti antibody3798A synthesized peptide derived from human CD271orb22464320 ulCD271 antibodyanti CD271 antibody, anti Gp80-LNGFR antibody, anti low affinity nerve growth factor receptor antibody, anti Low-affinity nerve growth factor receptor antibody, anti nerve growth factor receptor (TNFR superfamily antibody, anti member 16) antibody, anti NGF receptor antibody, anti NGFR antibody, anti p75 ICD antibody, anti p75(NTR) antibody, anti p75NTR antibody, anti antibody2736A synthesized peptide derived from human CD271orb22464350 ulCD271 antibodyanti CD271 antibody, anti Gp80-LNGFR antibody, anti low affinity nerve growth factor receptor antibody, anti Low-affinity nerve growth factor receptor antibody, anti nerve growth factor receptor (TNFR superfamily antibody, anti member 16) antibody, anti NGF receptor antibody, anti NGFR antibody, anti p75 ICD antibody, anti p75(NTR) antibody, anti p75NTR antibody, anti antibody3258A synthesized peptide derived from human CD271orb38587920 ugCD271 antibody3960Recombinant human protein was used as the immunogen for the CD271 antibody.orb385879100 ugCD271 antibody5850Recombinant human protein was used as the immunogen for the CD271 antibody.orb339198200 ulCD271 antibodyanti TNFRSF16 antibody, anti Tumor necrosis factor receptor superfamily member 16 antibody, anti Gp80-LNGFR antibody, anti Low affinity neurotrophin receptor p75NTR antibody, anti Low-affinity nerve growth factor receptor antibody, anti NGF receptor antibody, anti p75 ICD antibody, anti CD271 antibody4320orb339198100 ulCD271 antibodyanti TNFRSF16 antibody, anti Tumor necrosis factor receptor superfamily member 16 antibody, anti Gp80-LNGFR antibody, anti Low affinity neurotrophin receptor p75NTR antibody, anti Low-affinity nerve growth factor receptor antibody, anti NGF receptor antibody, anti p75 ICD antibody, anti CD271 antibody3870orb30558400 ulCD271 antibodyAnti-Tumor necrosis factor receptor superfamily member 16 antibody, anti-NGFR antibody, anti-TNFRSF16 antibody4050Immunogen is CD271 (C-term).orb154442100 TestsCD271 antibody (APC)5670Purified CD271 protein isolated from human melanoma cell line A875orb1798710.1 mgCD271 antibody (Biotin)4770Purified CD271 protein isolated from human melanoma cell line A875orb154501100 TestsCD271 antibody (PE )5670Purified CD271 protein isolated from human melanoma cell line A875orb10311100 ugCD272 antibodyanti-B and T lymphocyte associated antibody, anti-B and T lymphocyte associated protein antibody, anti-B and T lymphocyte attenuator antibody, anti-BTLA antibody, anti-BTLA1 antibody, anti-CD272 antibody, anti-CD272gen antibody, anti-FLJ16065 antibody, anti-MGC129743 antibody2970orb10311200 ugCD272 antibodyanti-B and T lymphocyte associated antibody, anti-B and T lymphocyte associated protein antibody, anti-B and T lymphocyte attenuator antibody, anti-BTLA antibody, anti-BTLA1 antibody, anti-CD272 antibody, anti-CD272gen antibody, anti-FLJ16065 antibody, anti-MGC129743 antibody3870orb73761100 ulCD272 antibodyanti CD272 antibody6228orb12640.5 mlCD274 antibody5040KLH-conjugated linear peptide from human PD-L1orb12200.5 mlCD274 antibody6948KLH-conjugated linear peptide from human PD-L1orb12201 mlCD274 antibody12186KLH-conjugated linear peptide from human PD-L1orb10162100 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.3330orb18977100 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.4500Peptide with sequence CKKQSDTHLEET, from the C Terminus of the protein sequence according to NP_054862.1; NP_001254635.1.orb11653100 ugCD274 antibodyanti BMI1 antibody4140A synthetic peptide corresponding to a sequence at the N-terminal of human CD274, different from the related rat and mouse sequences by one amino acidorb215908100 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.4860E.coli-derived human PD-L1 recombinant protein (Position: E45-T290). Human PD-L1 shares 69% amino acid (aa) sequence identity with mouse PD-L1.orb221213100 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.4050E.coli-derived human PD-L1 recombinant proteinorb371728100 ugCD274 antibodyanti-B7 H1 antibody, anti-B7H1 antibody, anti-B7-H1 antibody, anti-B7H1, PDCD1L1, PDCD1LG1, PDL1 antibody, anti-CD274 antigen antibody, anti-CD274 molecule antibody, anti-PD L1 antibody, anti-PD1L1 antibody, anti-PDCD1 ligand 1 antibody, anti-PDCD1L1 antibody, anti-PDCD1LG1 antibody, anti-PDL 1 antibody, anti-PD-L1 antibody, anti-Q9EP73 antibody4860E. coli-derived mouse PD-L1 recombinant protein (Position: F19-T238). Mouse PD-L1 shares 78.6% amino acid (aa) sequence identity with human PD-L1.orb389394100 ugCD274 antibody4860A synthetic peptide corresponding to a sequence at the N-terminus of human PD-L1/B7-H1orb156303100 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.2970KLH conjugated synthetic peptide derived from human PD-L1/CD274orb156303200 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.3870KLH conjugated synthetic peptide derived from human PD-L1/CD274orb182478100 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.3330KLH conjugated synthetic peptide derived from human CD274orb182478200 ugCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.4500KLH conjugated synthetic peptide derived from human CD274orb192276100 ulCD274 antibody4716orb316457100 ulCD274 antibody6390orb378642100 ulCD274 antibody4230Recombinant proteinorb379624100 ulCD274 antibody3960Recombinant fragment of human CD274 (AA: 24-153) expressed in E. Coli. orb380229100 ulCD274 antibody4716orb228661100 ulCD274 antibodyanti B7-H antibody, anti B7H1 antibody, anti MGC142294 antibody, anti MGC142296 antibody, anti PD-L1 antibody, anti PDCD1L1 antibody, anti PDCD1LG1 antibody, anti PDL1 antibody3798Recombinant protein of human CD274orb22866120 ulCD274 antibodyanti B7-H antibody, anti B7H1 antibody, anti MGC142294 antibody, anti MGC142296 antibody, anti PD-L1 antibody, anti PDCD1L1 antibody, anti PDCD1LG1 antibody, anti PDL1 antibody2736Recombinant protein of human CD274orb22866150 ulCD274 antibodyanti B7-H antibody, anti B7H1 antibody, anti MGC142294 antibody, anti MGC142296 antibody, anti PD-L1 antibody, anti PDCD1L1 antibody, anti PDCD1LG1 antibody, anti PDL1 antibody3258Recombinant protein of human CD274orb181567200 ulCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.6660KLH-conjugated synthetic peptide from C-terminal region of human CD274, Synthetic peptide (aa261-290)orb235069200 ulCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.4410orb235069100 ulCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.2970orb32884400 ulCD274 antibodyAnti-Programmed cell death 1 ligand 1 antibody, anti-CD274 antibody, anti-B7H1 antibody, anti-PDCD1L1 antibody, anti-PDCD1LG1 antibody, anti-PDL1 antibody4050This CD274 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 261-290 amino acids from the C-terminal region of human CD274.orb31487250 ulCD274 antibodyAnti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.6660Recombinant proteinorb35354850 ulCD274 antibodyanti-PD-L1 antibody, anti-PDCD1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody, anti-CD274 antibody, anti-B7H1 antibody, anti-PDCD1L1 antibody, anti-PDCD1LG1 antibody, anti-PDL1 antibody2520Recombinant human Programmed cell death 1 ligand 1 protein (19-238aa)orb353548100 ulCD274 antibodyanti-PD-L1 antibody, anti-PDCD1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody, anti-CD274 antibody, anti-B7H1 antibody, anti-PDCD1L1 antibody, anti-PDCD1LG1 antibody, anti-PDL1 antibody3420Recombinant human Programmed cell death 1 ligand 1 protein (19-238aa)orb13687050 ulCD274 antibodyanti B7-H antibody, anti B7H1 antibody, anti MGC142294 antibody, anti MGC142296 antibody, anti PD-L1 antibody, anti PDCD1L1 antibody, anti PDCD1LG1 antibody, anti PDL1 antibody3060Recombinant protein of human CD274orb136870100 ulCD274 antibodyanti B7-H antibody, anti B7H1 antibody, anti MGC142294 antibody, anti MGC142296 antibody, anti PD-L1 antibody, anti PDCD1L1 antibody, anti PDCD1LG1 antibody, anti PDL1 antibody4140Recombinant protein of human CD274orb136870200 ulCD274 antibodyanti B7-H antibody, anti B7H1 antibody, anti MGC142294 antibody, anti MGC142296 antibody, anti PD-L1 antibody, anti PDCD1L1 antibody, anti PDCD1LG1 antibody, anti PDL1 antibody6480Recombinant protein of human CD274orb377881100 ugCD274 antibody (Biotin)4500C Terminus (CKKQSDTHLEET. CKKQSDTHLEET.)orb186791100 ugCD274 antibody (FITC)Anti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.3870KLH conjugated synthetic peptide derived from human CD274orb360775100 ugCD274 antibody (FITC)Anti-CD274 antibody, anti-Programmed cell death 1 ligand 1 antibody, anti-Programmed death ligand 1 antibody, anti-B7 homolog 1 antibody, anti-B7-H1 antibody.3330Synthetic peptide (please contact us for details)orb179129100 TestsCD274 antibody (PE)anti PD-L1 antibody, anti B7-H1 antibody6030Recombinant Mouse PD-L1 / B7-H1 / CD274 proteinorb17912950 TestsCD274 antibody (PE)anti PD-L1 antibody, anti B7-H1 antibody4050Recombinant Mouse PD-L1 / B7-H1 / CD274 proteinorb14048100 ugCD275 antibody (FITC)anti-B7 homolog 2 antibody, anti-B7 like protein Gl50 antibody, anti-B7 related protein 1 antibody, anti-B7-H2 antibody, anti-B7RP-1 antibody, anti-CD275 antibody, anti-CD275gen antibody, anti-GL50 antibody, anti-ICOS-L antibody, anti-ICOSLG antibody, anti-KIAA0653 antibody, anti-LICOS antibody3870Synthetic peptide (please contact us for details)orb1791100 ugCD276 antibody4500C Terminus (C-KHSDSKEDDGQE)orb1258100 ugCD276 antibodyanti CD276 antibody,anti B7H3 antibody2970Synthetic peptide (please contact us for details)orb1258200 ugCD276 antibodyanti CD276 antibody,anti B7H3 antibody3870Synthetic peptide (please contact us for details)orb69315100 ulCD276 antibodyanti B7H3 antibody, anti B7-H3 antibody, anti 4Ig-B7-H3 antibody, anti CD276 antibody3960Purified recombinant fragment of human CD276 expressed in E. Coli.orb311232100 ulCD276 antibody4716KLH Conjugated synthetic peptideorb335127100 ulCD276 antibody3798A synthesized peptideorb33512750 ulCD276 antibody3258A synthesized peptideorb394610100 ulCD276 antibody3798Recombinant fragment of human CD276 expressed in E. Coliorb39461050 ulCD276 antibody3258Recombinant fragment of human CD276 expressed in E. Coliorb181560200 ulCD276 antibodyanti CD276 antibody, anti 4Ig-B7-H3 antibody, anti B7 homolog 3 antibody, anti B7-H3 antibody, anti CD276 antigen antibody, anti CD276 molecule antibody, anti Costimulatory molecule antibody, anti B7H3 antibody, anti B7RP-2 antibody6660KLH-conjugated synthetic peptide from C-terminal region of human CD276, Synthetic peptide (aa493-522)orb318852200 ulCD276 antibodyanti B7H3 antibody, anti CD276 antigen antibody, anti 4Ig-B7-H3 antibody, anti B7 homolog 3 antibody, anti B7-H3 antibody, anti Costimulatory molecule antibody, anti CD276 antibody4320orb318852100 ulCD276 antibodyanti B7H3 antibody, anti CD276 antigen antibody, anti 4Ig-B7-H3 antibody, anti B7 homolog 3 antibody, anti B7-H3 antibody, anti Costimulatory molecule antibody, anti CD276 antibody3060orb390055200 ulCD276 antibody6480A synthetic peptide of human CD276orb39005550 ulCD276 antibody3060A synthetic peptide of human CD276orb390055100 ulCD276 antibody4140A synthetic peptide of human CD276orb30805400 ulCD276 antibodyAnti-CD276 antigen antibody, anti-CD276 antibody, anti-B7H3 antibody4050This CD276 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 493-522 amino acids from the C-terminal region of human CD276.orb8831950 ugCD276 antibodyanti B7-H3 antibody6660orb4135650 ulCD276 antibody2520Recombinant human CD276 antigen proteinorb41356100 ulCD276 antibody3420Recombinant human CD276 antigen proteinorb4135750 ulCD276 antibody2520Recombinant human CD276 antigen proteinorb41357100 ulCD276 antibody3420Recombinant human CD276 antigen proteinorb3288100 ugCD276 antibody (FITC)anti CD276 antibody (FITC),anti B7H3 antibody (FITC)3870Synthetic peptide (please contact us for details)orb179137100 TestsCD276 antibody (PE)anti B7-H3 antibody6030Recombinant Human B7-H3 / CD276 proteinorb17913750 TestsCD276 antibody (PE)anti B7-H3 antibody4050Recombinant Human B7-H3 / CD276 proteinorb13482100 ugCD278 antibodyanti-Activation inducible lymphocyte immunomediatory molecule antibody, anti-AILIM antibody, anti-CD278 antibody, anti-CD278gen antibody, anti-ICOS antibody, anti-Inducible costimulator antibody, anti-Inducible T cell co-stimulator antibody, anti-MGC39850 antibody2970Synthetic peptide (please contact us for details)orb13482200 ugCD278 antibodyanti-Activation inducible lymphocyte immunomediatory molecule antibody, anti-AILIM antibody, anti-CD278 antibody, anti-CD278gen antibody, anti-ICOS antibody, anti-Inducible costimulator antibody, anti-Inducible T cell co-stimulator antibody, anti-MGC39850 antibody3870Synthetic peptide (please contact us for details)orb315788200 ulCD278 antibodyanti AILIM antibody, anti Inducible T-cell costimulator antibody, anti Activation-inducible lymphocyte immunomediatory molecule antibody, anti CD278 antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD278. The exact sequence is proprietary.orb315788100 ulCD278 antibodyanti AILIM antibody, anti Inducible T-cell costimulator antibody, anti Activation-inducible lymphocyte immunomediatory molecule antibody, anti CD278 antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD278. The exact sequence is proprietary.orb14047100 ugCD278 antibody (FITC)anti-Activation inducible lymphocyte immunomediatory molecule antibody, anti-AILIM antibody, anti-CD278 antibody, anti-CD278gen antibody, anti-ICOS antibody, anti-Inducible costimulator antibody, anti-Inducible T cell co-stimulator antibody, anti-MGC39850 antibody3870Synthetic peptide (please contact us for details)orb387900100 TestsCD279 antibody (PE)5670orb73525100 ulCD27L antibodyanti CD27L antibody6228orb337531100 ulCD28 (Phospho-Tyr218) antibody3798A synthesized peptide derived from human CD28 (Phospho-Tyr218)orb33753150 ulCD28 (Phospho-Tyr218) antibody3258A synthesized peptide derived from human CD28 (Phospho-Tyr218)orb213691200 ulCD28 (phospho-Y218) antibodyanti T-cell-specific surface glycoprotein CD28 antibody, anti TP44 antibody, anti CD28 antibody5040orb213691100 ulCD28 (phospho-Y218) antibodyanti T-cell-specific surface glycoprotein CD28 antibody, anti TP44 antibody, anti CD28 antibody3420orb437220.1 mgCD28 antibodyAnti-CD28 antibody3690orb437230.1 mgCD28 antibodyAnti-CD28 antibody3690orb447370.1 mgCD28 antibodyAnti-CD28 (rat) antibody3870orb448470.1 mgCD28 antibodyAnti-Hamster Monoclonal to CD28 (mouse) antibody3330orb263970.5 mgCD28 antibodyAnti-CD28 antibody, anti-CD28 Primary antibodies, anti-MAb to Mouse CD28 antibody, CD28 Primary antibodies, CD28 is a monoclonal antibody to non-human cds.7020orb22528100 ugCD28 antibodyanti -T-cell-specific surface glycoprotein antibody, anti-CD28 antigen (Tp44) antibody, anti-CD28 antigen antibody, anti-Tp44 antibody, anti-MGC138290 antibody, anti-CD28 molecule antibody, anti-CD28 antibody 4500orb22561100 ugCD28 antibodyanti -T-cell-specific surface glycoprotein CD28 antibody, anti-OTTMUSP00000002157 antibody, anti-CH29-189K17.3 antibody, anti-CD28 antigen antibody, anti-Cd28 antibody 4500orb198040100 ugCD28 antibody3600CD28: Derived from the hybridization of mouse Sp2/O-Ag14 myeloma cells with spleen cells of BALB/c mice immunized with the HPB-ALL T-cell line.orb301821100 ugCD28 antibody4950orb378206100 ugCD28 antibody3330orb388884100 ugCD28 antibody4356Recombinant human CD28 proteinorb388885100 ugCD28 antibody4356Recombinant human CD28 proteinorb388886100 ugCD28 antibody4356Recombinant human CD28 proteinorb388887100 ugCD28 antibody4356Stimulated human leucocytesorb388888100 ugCD28 antibody4356Recombinant human full-length CD28 proteinorb156304100 ugCD28 antibodyanti-CD 28 antibody, anti-CD28 antigen antibody, anti-CD28 molecule antibody, anti-MGC138290 antibody, anti-T cell antigen CD28 antibody, anti-T cell specic surface glycoprotein antibody, anti-T cell specic surface glycoprotein CD28 antibody, anti-Tp44 antibody, anti-CD28_HUMAN antibody3330KLH conjugated synthetic peptide derived from human CD28orb156304200 ugCD28 antibodyanti-CD 28 antibody, anti-CD28 antigen antibody, anti-CD28 molecule antibody, anti-MGC138290 antibody, anti-T cell antigen CD28 antibody, anti-T cell specic surface glycoprotein antibody, anti-T cell specic surface glycoprotein CD28 antibody, anti-Tp44 antibody, anti-CD28_HUMAN antibody4500KLH conjugated synthetic peptide derived from human CD28orb389337100 ugCD28 antibody3330orb389337200 ugCD28 antibody4500orb311192100 ulCD28 antibody4716KLH Conjugated synthetic peptideorb26503100 TestsCD28 antibodyCD28, Anti-CD28 antibody, anti-CD28 Primary antibodies, anti-MAb to CD28 antibody, CD28 Primary antibodies, CD28 is a monoclonal antibody to human cds.5940Transfected murine cell line.orb43727100 testsCD28 antibodyAnti-CD28 antibody5670orb5599420 ugCD28 antibody3960Recombinant human protein was used as the immunogen for this CD28 antibody.orb55994100 ugCD28 antibody5850Recombinant human protein was used as the immunogen for this CD28 antibody.orb5599620 ugCD28 antibody3960Recombinant human CD28 protein was used as the immunogen for this antibody.orb55996100 ugCD28 antibody5850Recombinant human CD28 protein was used as the immunogen for this antibody.orb5599720 ugCD28 antibody3960Recombinant human CD28 protein was used as the immunogen for this antibody.orb55997100 ugCD28 antibody5850Recombinant human CD28 protein was used as the immunogen for this antibody.orb5622220 ugCD28 antibody3960Stimulated human leukocytes were used as the immunogen for the CD28 antibody.orb56222100 ugCD28 antibody5850Stimulated human leukocytes were used as the immunogen for the CD28 antibody.orb5630820 ugCD28 antibody3960Recombinant human protein was used as the immunogen for this CD28 antibody.orb56308100 ugCD28 antibody5850Recombinant human protein was used as the immunogen for this CD28 antibody.orb308463200 ugCD28 antibodyanti CD28 antibody3780U266 cell lineorb230634200 ugCD28 antibody6030orb23063450 ugCD28 antibody3420orb230634100 ugCD28 antibody4680orb231395200 ugCD28 antibody6030orb23139550 ugCD28 antibody3420orb231395100 ugCD28 antibody4680orb362086200 ugCD28 antibody6030Recombinant mouse CD28 Protein orb36208650 ugCD28 antibody3420Recombinant mouse CD28 Protein orb362086100 ugCD28 antibody4680Recombinant mouse CD28 Protein orb362165200 ugCD28 antibody6030Recombinant rat CD28 Protein orb36216550 ugCD28 antibody3420Recombinant rat CD28 Protein orb362165100 ugCD28 antibody4680Recombinant rat CD28 Protein orb308466200 TestsCD28 antibodyanti CD28 antibody3780U266 cell lineorb231394400 ugCD28 antibody6030orb231394100 ugCD28 antibody3420orb231394200 ugCD28 antibody4680orb37252400 ulCD28 antibodyAnti-T-cell-specific surface glycoprotein CD28 antibody, anti-TP44 antibody, anti-CD_antigen=CD28 antibody, anti-Flags: Precursor antibody, anti-CD28 antibody4050This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28.orb10295100 ugCD28 antibody3330orb10295200 ugCD28 antibody4500orb19546250 ugCD28 antibodyanti CD28 antibody, anti CD28 antigen antibody, anti CD28 antigen (Tp44) antibody, anti Tp44 antibody, anti CD28 molecule antibody6660Mouse T cell lymphoma EL-4 cells.orb23063550 ugCD28 antibody4050orb230635100 ugCD28 antibody6030orb22695500 ugCD28 antibody3996Purified mouse purified mouse LN cells.orb226951 mgCD28 antibody6840Purified mouse purified mouse LN cells.orb198254100 TestsCD28 antibody (APC)5670CD28: Derived from the hybridization of mouse Sp2/O-Ag14 myeloma cells with spleen cells of BALB/c mice immunized with the HPB-ALL T-cell line.orb22696500 ugCD28 antibody (Biotin)5940Purified mouse purified mouse LN cells.orb226961 mgCD28 antibody (Biotin)7020Purified mouse purified mouse LN cells.orb1544790.1 mgCD28 antibody (FITC)4410Mouse A20J B lymphoma cells transfected with rat CD28orb15289100 ugCD28 antibody (FITC)3870Synthetic peptide (please contact us for details)orb43725100 testsCD28 antibody (FITC)Anti-CD28 antibody4770orb198097100 TestsCD28 antibody (FITC)4140CD28: Derived from the hybridization of mouse Sp2/O-Ag14 myeloma cells with spleen cells of BALB/c mice immunized with the HPB-ALL T-cell line.orb308464100 TestsCD28 antibody (FITC)anti CD28 antibody3780U266 cell lineorb36111650 TestCD28 antibody (FITC)4050Recombinant human CD28 Protein orb361116100 TestCD28 antibody (FITC)6030Recombinant human CD28 Protein orb22697500 ugCD28 antibody (FITC)5940Purified mouse purified mouse LN cells.orb226971 mgCD28 antibody (FITC)7020Purified mouse purified mouse LN cells.orb198276100 TestsCD28 antibody (FITC, PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD28: Derived from the hybridization of mouse Sp2/O-Ag14 myeloma cells with spleen cells of BALB/c mice immunized with the orb19815650 TestsCD28 antibody (FITC, PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD28: Derived from the hybridization of mouse Sp2/O-Ag14 myeloma cells with spleen cells of BALB/c mice immunized with the orb1545080.1 mgCD28 antibody (PE )4770Mouse A20J B lymphoma cells transfected with rat CD28orb43726100 testsCD28 antibody (PE)Anti-CD28 antibody5670orb198148100 TestsCD28 antibody (PE)4590CD28: Derived from the hybridization of mouse Sp2/O-Ag14 myeloma cells with spleen cells of BALB/c mice immunized with the HPB-ALL T-cell line.orb308465100 TestsCD28 antibody (PE)anti CD28 antibody4230U266 cell lineorb55995100 TestsCD28 antibody (PE)6570Recombinant human CD28 protein was used as the immunogen for this antibody.orb43728100 testsCD28 antibody (PerCP)Anti-CD28 antibody5670orb27294100 ugCD282 antibodyCD282 (TLR2), human9036CHO-TLR2 cellsorb158851100 ugCD282 antibodyTLR2 antibody2700orb158851500 ugCD282 antibodyTLR2 antibody5040orb248906200 ulCD282 antibodyanti TLR2 antibody, anti TIL4 antibody, anti Toll-like receptor 2 antibody, anti Toll/interleukin-1 receptor-like protein 4 antibody, anti CD antigen CD282 antibody5220orb24890650 ulCD282 antibodyanti TLR2 antibody, anti TIL4 antibody, anti Toll-like receptor 2 antibody, anti Toll/interleukin-1 receptor-like protein 4 antibody, anti CD antigen CD282 antibody3150orb248906100 ulCD282 antibodyanti TLR2 antibody, anti TIL4 antibody, anti Toll-like receptor 2 antibody, anti Toll/interleukin-1 receptor-like protein 4 antibody, anti CD antigen CD282 antibody3600orb43191100 ugCD283 antibodyanti TLR3 antibody, anti-TLR3/CD283 antibody4680Recombinant mouse TLR3 protein.orb4319150 ugCD283 antibodyanti TLR3 antibody, anti-TLR3/CD283 antibody3420Recombinant mouse TLR3 protein.orb43191200 ugCD283 antibodyanti TLR3 antibody, anti-TLR3/CD283 antibody6030Recombinant mouse TLR3 protein.orb43190200 ugCD283 antibodyanti TLR3 antibody, anti-TLR3/CD283 antibody4680Recombinant mouse TLR3 protein.orb43190100 ugCD283 antibodyanti TLR3 antibody, anti-TLR3/CD283 antibody3420Recombinant mouse TLR3 protein.orb43190400 ugCD283 antibodyanti TLR3 antibody, anti-TLR3/CD283 antibody6030Recombinant mouse TLR3 protein.orb160317100 ugCD284 antibody2970Synthesized peptide derived from the Internal region of human CD284.orb310238100 ulCD284 antibody4716KLH Conjugated synthetic peptideorb229951200 ugCD286 antibody6030orb22995150 ugCD286 antibody3420orb229951100 ugCD286 antibody4680orb311438100 ulCD292 antibody4716KLH Conjugated synthetic peptideorb235049200 ulCD292 antibodyanti ACVRLK3 antibody, anti ALK3 antibody, anti Bone morphogenetic protein receptor type-1A antibody, anti BMP type-1A receptor antibody, anti BMPR-1A antibody, anti Activin receptor-like kinase 3 antibody, anti ALK-3 antibody, anti Serine/threonine-protein kinase receptor R5 antibody, anti SKR5 antibody, anti CD292 antibody4410orb235049100 ulCD292 antibodyanti ACVRLK3 antibody, anti ALK3 antibody, anti Bone morphogenetic protein receptor type-1A antibody, anti BMP type-1A receptor antibody, anti BMPR-1A antibody, anti Activin receptor-like kinase 3 antibody, anti ALK-3 antibody, anti Serine/threonine-protein kinase receptor R5 antibody, anti SKR5 antibody, anti CD292 antibody2970orb311331100 ulCD294 antibody4716KLH Conjugated synthetic peptideorb339141200 ulCD295 antibodyanti DB antibody, anti OBR antibody, anti Leptin receptor antibody, anti LEP-R antibody, anti HuB219 antibody, anti OB receptor antibody, anti OB-R antibody, anti CD295 antibody4320orb339141100 ulCD295 antibodyanti DB antibody, anti OBR antibody, anti Leptin receptor antibody, anti LEP-R antibody, anti HuB219 antibody, anti OB receptor antibody, anti OB-R antibody, anti CD295 antibody3870orb315755200 ulCD296 antibodyanti GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 antibody, anti ADP-ribosyltransferase C2 and C3 toxin-like 1 antibody, anti ARTC1 antibody, anti Mono(ADP-ribosyl)transferase 1 antibody, anti CD296 antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD296. The exact sequence is proprietary.orb315755100 ulCD296 antibodyanti GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 antibody, anti ADP-ribosyltransferase C2 and C3 toxin-like 1 antibody, anti ARTC1 antibody, anti Mono(ADP-ribosyl)transferase 1 antibody, anti CD296 antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD296. The exact sequence is proprietary.orb231776200 ugCD297 antibody6030orb23177650 ugCD297 antibody3420orb231776100 ugCD297 antibody4680orb232024200 ugCD297 antibody6030orb23202450 ugCD297 antibody3420orb232024100 ugCD297 antibody4680orb232025200 ugCD297 antibody6030orb23202550 ugCD297 antibody3420orb232025100 ugCD297 antibody4680orb231775400 ugCD297 antibody6030orb231775100 ugCD297 antibody3420orb231775200 ugCD297 antibody4680orb160318100 ugCD298 antibody2970Synthesized peptide derived from the Internal region of human CD298.orb311528100 ulCD298 antibody4716KLH Conjugated synthetic peptideorb34581050 ugCD2AP (phospho-Y4-8-10) antibody6390Synthetic peptide (N-Terminus)orb258026100 ugCD2AP antibodyanti CD2AP antibody4500Synthetic peptideorb258027100 ugCD2AP antibodyanti CD2AP antibody4500Synthetic peptideorb10312100 ugCD2AP antibodyanti-Adapter protein CMS antibody, anti-AL024079 antibody, anti-C78928 antibody, anti-Cas ligand with multiple SH3 domains antibody, anti-CD2AP antibody, anti-CD2-associated protein antibody, anti-CMS antibody, anti-DKFZP586H0519 antibody, anti-Mesenchyme to epithelium transition protein with SH3 domains 1 antibody, anti-METS 1 antibody2970orb10312200 ugCD2AP antibodyanti-Adapter protein CMS antibody, anti-AL024079 antibody, anti-C78928 antibody, anti-Cas ligand with multiple SH3 domains antibody, anti-CD2AP antibody, anti-CD2-associated protein antibody, anti-CMS antibody, anti-DKFZP586H0519 antibody, anti-Mesenchyme to epithelium transition protein with SH3 domains 1 antibody, anti-METS 1 antibody3870orb253814100 ulCD2AP antibody4716KLH conjugated synthetic peptideorb335128100 ulCD2AP antibody3798A synthesized peptideorb33512850 ulCD2AP antibody3258A synthesized peptideorb377976200 ulCD2AP antibody6210Recombinant full length protein of human CD2APorb377976100 ulCD2AP antibody4050Recombinant full length protein of human CD2APorb373765200 ulCD2AP antibody6480A synthetic peptide of human CD2APorb37376550 ulCD2AP antibody3060A synthetic peptide of human CD2APorb373765100 ulCD2AP antibody4140A synthetic peptide of human CD2APorb17904450 ulCD2AP antibodyanti CD2AP antibody, anti Adapter protein CMS antibody, anti CMS antibody, anti CD2-associated protein antibody6660Synthetic peptideorb15260100 ugCD2AP antibody (FITC)anti-Adapter protein CMS antibody, anti-AL024079 antibody, anti-C78928 antibody, anti-Cas ligand with multiple SH3 domains antibody, anti-CD2AP antibody, anti-CD2-associated protein antibody, anti-CMS antibody, anti-DKFZP586H0519 antibody, anti-Mesenchyme to epithelium transition protein with SH3 domains 1 antibody, anti-METS 1 antibody3870Synthetic peptide (please contact us for details)orb327350100 ulCD2B2 antibodyanti CD2BP2 antibody, anti KIAA1178 antibody, anti antibody5760The immunogen is a Synthetic peptide directed towards the C-terminal region of Human CD2B2orb312196100 ugCD2BP1 antibodyanti CD2 antigen binding protein 1 antibody, anti CD2 binding protein 1 antibody, anti CD2 cytoplasmic tail binding protein antibody, anti CD2-binding protein 1 antibody, anti CD2BP1 antibody, anti CD2BP1L antibody, anti CD2BP1S antibody, anti H PIP antibody, anti H-PIP antibody, anti HPIP antibody, anti PAPAS antibody, anti PEST phosphatase interacting protein 1 antibody, anti PEST phosphatase-interacting protein 1 antibody, anti PPIP1_HUMAN antibody, anti Proline serine threonine phosphatase interacting protein 1 antibody, anti Proline-serine-threonine phosphatase-interacting protein 1 antibody, anti PSTPIP antibody, anti Pstpip1 antibody2970KLH conjugated synthetic peptide derived from human CD2BP1/PSTPIP1orb312196200 ugCD2BP1 antibodyanti CD2 antigen binding protein 1 antibody, anti CD2 binding protein 1 antibody, anti CD2 cytoplasmic tail binding protein antibody, anti CD2-binding protein 1 antibody, anti CD2BP1 antibody, anti CD2BP1L antibody, anti CD2BP1S antibody, anti H PIP antibody, anti H-PIP antibody, anti HPIP antibody, anti PAPAS antibody, anti PEST phosphatase interacting protein 1 antibody, anti PEST phosphatase-interacting protein 1 antibody, anti PPIP1_HUMAN antibody, anti Proline serine threonine phosphatase interacting protein 1 antibody, anti Proline-serine-threonine phosphatase-interacting protein 1 antibody, anti PSTPIP antibody, anti Pstpip1 antibody3870KLH conjugated synthetic peptide derived from human CD2BP1/PSTPIP1orb19020100 ugCD2BP2 antibodyanti FWP010 antibody, anti LIN1 antibody, anti Snu40 antibody, anti CD2 antigen (cytoplasmic tail) binding protein 2 antibody, anti CD2 (cytoplasmic tail) binding protein 2 antibody, anti CD2 antigen (cytoplasmic tail)-binding protein 2 antibody, anti U5-52K antibody, anti CD2 binding protein 2 antibody, anti CD2 cytoplasmic domain binding protein 2 antibody, anti U5 snRNP 52K protein antibody4500orb160319100 ugCD2BP2 antibody2970Synthesized peptide derived from the Internal region of human CD2BP2.orb310239100 ulCD2BP2 antibody4716KLH Conjugated synthetic peptideorb224068200 ulCD2BP2 antibodyanti KIAA1178 antibody, anti CD2 antigen cytoplasmic tail-binding protein 2 antibody, anti CD2 cytoplasmic domain-binding protein 2 antibody, anti CD2 tail-binding protein 2 antibody, anti U5 snRNP 52K protein antibody, anti U5-52K antibody4410orb224068100 ulCD2BP2 antibodyanti KIAA1178 antibody, anti CD2 antigen cytoplasmic tail-binding protein 2 antibody, anti CD2 cytoplasmic domain-binding protein 2 antibody, anti CD2 tail-binding protein 2 antibody, anti U5 snRNP 52K protein antibody, anti U5-52K antibody2970orb28892400 ulCD2BP2 antibodyAnti-CD2 antigen cytoplasmic tail-binding protein 2 antibody, anti-CD2BP2 antibody, anti-KIAA1178 antibody4050This CD2BP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human CD2BP2.orb37535950 ugCD2BP2 antibody6660Synthetic peptideorb42126100 ugCD2gen antibodyanti CD2 antibody, anti-CD2/SRBC antibody4680Recombinant human CD2 protein.orb4212650 ugCD2gen antibodyanti CD2 antibody, anti-CD2/SRBC antibody3420Recombinant human CD2 protein.orb42126200 ugCD2gen antibodyanti CD2 antibody, anti-CD2/SRBC antibody6030Recombinant human CD2 protein.orb42128100 ugCD2gen antibodyanti CD2 antibody, anti-CD2/LY37 antibody4680Recombinant mouse CD2 protein.orb4212850 ugCD2gen antibodyanti CD2 antibody, anti-CD2/LY37 antibody3420Recombinant mouse CD2 protein.orb42128200 ugCD2gen antibodyanti CD2 antibody, anti-CD2/LY37 antibody6030Recombinant mouse CD2 protein.orb42127200 ugCD2gen antibodyanti CD2 antibody, anti-CD2/LY37 antibody4680Recombinant mouse CD2 protein.orb42127100 ugCD2gen antibodyanti CD2 antibody, anti-CD2/LY37 antibody3420Recombinant mouse CD2 protein.orb42127400 ugCD2gen antibodyanti CD2 antibody, anti-CD2/LY37 antibody6030Recombinant mouse CD2 protein.orb176412200 ugCD2gen antibodyanti CD2 antibody6030Recombinant Human CD2 protein. Produced in rabbits immunized with purified, recombinant Human CD2orb17641250 ugCD2gen antibodyanti CD2 antibody3420Recombinant Human CD2 protein. Produced in rabbits immunized with purified, recombinant Human CD2orb176412100 ugCD2gen antibodyanti CD2 antibody4680Recombinant Human CD2 protein. Produced in rabbits immunized with purified, recombinant Human CD2orb171427400 ugCD2gen antibodyanti CD2 antibody6030Recombinant Human CD2 protein. Produced in rabbits immunized with purified, recombinant Human CD2orb171427100 ugCD2gen antibodyanti CD2 antibody3420Recombinant Human CD2 protein. Produced in rabbits immunized with purified, recombinant Human CD2orb171427200 ugCD2gen antibodyanti CD2 antibody4680Recombinant Human CD2 protein. Produced in rabbits immunized with purified, recombinant Human CD2orb17079150 ugCD2gen antibodyanti CD2 antibody4050Recombinant Mouse CD2 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD2orb170791100 ugCD2gen antibodyanti CD2 antibody6030Recombinant Mouse CD2 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Mouse CD2orb193614100 ulCD2L1 antibodyanti CD2L1 antibody, anti CDC2L1 antibody, anti CDK11 antibody, anti CLK-1 antibody, anti Cell division cycle 2-like 1 antibody4716Synthesized peptide derived from N-terminal of human CD2L1.orb336212100 ulCD2L5 antibody3798A synthesized peptide derived from human CD2L5orb33621250 ulCD2L5 antibody3258A synthesized peptide derived from human CD2L5orb336213100 ulCD2L6 antibody3798A synthesized peptide derived from human CD2L6orb33621350 ulCD2L6 antibody3258A synthesized peptide derived from human CD2L6orb336214100 ulCD2L7 antibody3798A synthesized peptide derived from human CD2L7orb33621450 ulCD2L7 antibody3258A synthesized peptide derived from human CD2L7orb16255100 ugCD3 (CT) antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3870Synthetic peptide (please contact us for details)orb445950.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3960orb443370.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690orb443380.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690orb444160.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3960orb445590.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690orb445600.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690orb445920.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3330orb445930.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3330orb446790.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4140orb447460.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690orb447470.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690orb2227990.1 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3960Human peripheral blood lymphocytes.orb2236680.1 mlCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody5400Human infant thymocytes and Sezary cells.orb265330.2 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody7956Hodgkin's derived cell line L540orb261270.2 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody5706Human infant thymocytes and Sezary cellsorb1800410.2 mgCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4680orb3152340.5 mgCD3 antibody8280orb3021431 mlCD3 antibody11970orb3031241 mlCD3 antibody11610orb3017791 mlCD3 antibody3600orb3017795 mlCD3 antibody9810orb18193100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4140Human thymocytes followed by Sezary T cells.orb196263100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4860E.coli-derived human CD3 epsilon recombinant proteinorb198023100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3600CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb198484100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4500Internal region RKGQRDLYSGLNQRorb198485100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4500Internal region HETGRLSGAADTQorb198490100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4500Internal region QDGVRQSRASDKQTorb198495100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4500Internal region KNPQEGLYNELQKDorb301780100 ugCD3 antibody5850orb323391100 ugCD3 antibody3510CD4+ transfectant followed by CEM cellsorb389781100 ugCD3 antibody3690Human thymocytesorb10313100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3330orb10313200 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4500orb11306100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970orb11306200 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870orb11307100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970Synthetic peptide (please contact us for details)orb11307200 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3870Synthetic peptide (please contact us for details)orb11308100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970Synthetic peptide (please contact us for details)orb11308200 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3870Synthetic peptide (please contact us for details)orb156305100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970KLH conjugated synthetic peptide derived from pig CD3orb156305200 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3870KLH conjugated synthetic peptide derived from pig CD3orb348965100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970orb348965200 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870orb42186100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6030Recombinant human CD3D protein.orb4218650 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050Recombinant human CD3D protein.orb11921100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2700orb11921500 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody5040orb68955100 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3960Purified recombinant fragment of human CD3 expressed in E. Coli.orb69238100 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3960Purified recombinant fragment of human CD247 expressed in E. Coli.orb192489100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4716Recombinant protein of human CD247.orb194554100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4716Synthesized peptide derived from internal of human CD3EAP.orb394512100 ulCD3 antibody3798Recombinant fragment of human CD3 expressed in E. Coliorb39451250 ulCD3 antibody3258Recombinant fragment of human CD3 expressed in E. Coliorb228923100 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3798Recombinant protein of human CD3orb22892320 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2736Recombinant protein of human CD3orb22892350 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3258Recombinant protein of human CD3orb226523100 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3798A synthesized peptideorb22652320 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2736A synthesized peptideorb22652350 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3258A synthesized peptideorb228505100 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3798Recombinant protein of human CD3orb22850520 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2736Recombinant protein of human CD3orb22850550 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3258Recombinant protein of human CD3orb44342100 testsCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody5670orb44563100 testsCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody5670orb24822520 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3960Amino acids ERPPPVPNPDYEP (156-168) were used as the immunogen for this CD3e antibody.orb248225100 ugCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody5850Amino acids ERPPPVPNPDYEP (156-168) were used as the immunogen for this CD3e antibody.orb38566720 ugCD3 antibody3960Human T cell leukemia cells were used as immunogen for the CD3 antibody.orb385667100 ugCD3 antibody5850Human T cell leukemia cells were used as immunogen for the CD3 antibody.orb38566820 ugCD3 antibody3960Human peripheral lymphocytes were used as immunogen for the CD3 antibody.orb385668100 ugCD3 antibody5850Human peripheral lymphocytes were used as immunogen for the CD3 antibody.orb308419200 ugCD3 antibodyanti CD3 antibody3780PHA activated T cellsorb170627200 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6030Recombinant Human CD3d/CD3 delta protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD3d/CD3 deltaorb17062750 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3420Recombinant Human CD3d/CD3 delta protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD3d/CD3 deltaorb170627100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4680Recombinant Human CD3d/CD3 delta protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD3d/CD3 deltaorb213684200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4410orb213684100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970orb213685200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4410orb213685100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970orb215447200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4410orb215447100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970orb235068200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4410orb235068100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2970orb248908200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody5220orb24890850 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3150orb248908100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3600orb248910200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody5220orb24891050 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3150orb248910100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3600orb308420200 TestsCD3 antibodyanti CD3 antibody3780PHA activated T cellsorb31614400 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050This CD3E antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-182 amino acids from the C-terminal region of human CD3E.orb32246400 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050This CD3Z antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 113-141 amino acids from the C-terminal region of human CD3Z.orb32245400 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050This CD3Z antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2-31 amino acids from the N-terminal region of human CD3Z.orb33194400 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050This CD3G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 48-76 amino acids from the N-terminal region of human CD3G.orb167090400 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050This CD3 antibody is generated from mouse immunized with human CD3.orb9502650 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody7470Recombinant protein with GST tagorb37531250 ugCD3 antibody6660Synthetic peptideorb17106750 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4050Recombinant Human CD3D/CD3 Delta protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD3D/CD3 Deltaorb171067100 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6030Recombinant Human CD3D/CD3 Delta protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD3D/CD3 Deltaorb8944050 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6660orb37589650 ulCD3 antibody6660orb4830650 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3060Recombinant protein of human CD247orb48306100 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4140Recombinant protein of human CD247orb48306200 ulCD3 antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6480Recombinant protein of human CD247orb22638500 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3996Purified human PBL cells.orb226381 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6840Purified human PBL cells.orb22686500 ugCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3996purified mouse LN cells.orb226861 mgCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6840purified mouse LN cells.orb178444500 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6552peptide derived from cytoplasmic, C-terminal region of human CD3-epsilon chainorb1784441 mlCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody10350peptide derived from cytoplasmic, C-terminal region of human CD3-epsilon chainorb178444100 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4842peptide derived from cytoplasmic, C-terminal region of human CD3-epsilon chainorb178444200 ulCD3 antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6678peptide derived from cytoplasmic, C-terminal region of human CD3-epsilon chainorb113531100 ulCD3 antibody (Alkaline Phosphatase)anti CD 3 antibody (Alkaline Phosphatase), anti Cd247 antibody (Alkaline Phosphatase), anti CD247 antigen antibody (Alkaline Phosphatase), anti CD247 antigen, zeta subunit antibody (Alkaline Phosphatase), anti CD247 molecule antibody (Alkaline Phosphatase), anti CD3 antibody (Alkaline Phosphatase), anti CD3 antigen, delta subunit antibody (Alkaline Phosphatase), anti CD3 delta antibody (Alkaline Phosphatase), anti CD3 epsilon antibody (Alkaline Phosphatase), anti CD3 eta antibody (Alkaline Phosphatase), anti CD3 gamma antibody (Alkaline Phosphatase), anti CD3 molecule delta polypeptide antibody (Alkaline Phosphatase), anti CD3 molecule, epsilon polypeptide antibody (Alkaline Phosphatase), anti CD3 molecule, gamma polypeptide antibody (Alkaline Phosphatase), anti CD3 zeta antibody (Alkaline Phosphatase), anti CD3-DELTA antibody (Alkaline Phosphatase), anti CD3D antibody (Alkaline Phosphatase), anti CD3D antigen delta polypeptide antibody (Alkaline Phosphatase), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Alkaline Phosphatase), anti CD3d molecule delta antibody (Alkaline Phosphatase), anti CD3d molecule delta CD3 TCR complex antibody (Alkaline Phosphatase), anti CD3d molecule, delta (CD3-TCR complex) antibody (Alkaline Phosphatase), anti CD3E antibody (Alkaline Phosphatase), anti CD3e antigen antibody (Alkaline Phosphatase), anti CD3E antigen epsilon polypeptide antibody (Alkaline Phosphatase), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Alkaline Phosphatase), anti CD3e molecule epsilon antibody (Alkaline Phosphatase), anti CD3e molecule epsilon CD3 TCR complex antibody (Alkaline Phosphatase), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Alkaline Phosphatase), anti CD3epsilon antibody (Alkaline Phosphatase), anti CD3G antibody (Alkaline Phosphatase), anti CD3g antigen antibody (Alkaline Phosphatase), anti CD3G antigen gamma polypeptide antibody (Alkaline Phosphatase), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Alkaline Phosphatase), anti CD3g molecule gamma antibody (Alkaline Phosphatase), anti CD3g molecule gamma CD3 TCR complex antibody (Alkaline Phosphatase), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Alkaline Phosphatase), anti CD3H antibody (Alkaline Phosphatase), anti CD3Q antibody (Alkaline Phosphatase), anti CD3Z antibody (Alkaline Phosphatase), anti CD3zeta antibody (Alkaline Phosphatase), anti Ctg3 antibody (Alkaline Phosphatase), anti IMD19 antibody (Alkaline Phosphatase), anti Leu-4 antibody (Alkaline Phosphatase), anti OKT3, delta chain antibody (Alkaline Phosphatase), anti T cell receptor antibody (Alkaline Phosphatase), anti T cell receptor T3 delta chain antibody (Alkaline Phosphatase), anti T cell receptor T3 gamma chain antibody (Alkaline Phosphatase), anti T cell receptor T3 zeta chain antibody (Alkaline Phosphatase), anti T cell receptor zeta chain antibody (Alkaline Phosphatase), anti T cell surface antigen antibody (Alkaline Phosphatase), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Alkaline Phosphatase), anti T cell surface glycoprotein CD3 antibody (Alkaline Phosphatase), anti T cell surface glycoprotein CD3 delta chain antibody (Alkaline Phosphatase), anti T cell surface glycoprotein CD3 epsilon chain antibody (Alkaline Phosphatase), anti T cell surface glycoprotein CD3 gamma chain antibody (Alkaline Phosphatase), anti T cell surface glycoprotein CD3 zeta chain antibody (Alkaline Phosphatase), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Alkaline Phosphatase), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Alkaline Phosphatase), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Alkaline Phosphatase), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Alkaline Phosphatase), anti T-cell receptor T3 delta chain antibody (Alkaline Phosphatase), anti T-cell receptor T3 gamma chain antibody (Alkaline Phosphatase), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Alkaline Phosphatase), anti T-cell surface glycoprotein CD3 delta chain antibody (Alkaline Phosphatase), anti T-cell surface glycoprotein CD3 gamma chain antibody (Alkaline Phosphatase), anti T3 antibody (Alkaline Phosphatase), anti T3D antibody (Alkaline Phosphatase), anti T3E antibody (Alkaline Phosphatase), anti T3G antibody (Alkaline Phosphatase), anti T3Z antibody (Alkaline Phosphatase), anti TCRE antibody (Alkaline Phosphatase), anti TCRk antibody (Alkaline Phosphatase), anti TCRZ antibody (Alkaline Phosphatase), anti TCRzeta antibody (Alkaline Phosphatase)3870Synthetic peptide (Please contact us for more details)orb198247100 TestsCD3 antibody (APC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody5670CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb24871250 AssaysCD3 antibody (APC)anti CD 3 antibody (APC), anti Cd247 antibody (APC), anti CD247 antigen antibody (APC), anti CD247 antigen, zeta subunit antibody (APC), anti CD247 molecule antibody (APC), anti CD3 antibody (APC), anti CD3 antigen, delta subunit antibody (APC), anti CD3 delta antibody (APC), anti CD3 epsilon antibody (APC), anti CD3 eta antibody (APC), anti CD3 gamma antibody (APC), anti CD3 molecule delta polypeptide antibody (APC), anti CD3 molecule, epsilon polypeptide antibody (APC), anti CD3 molecule, gamma polypeptide antibody (APC), anti CD3 zeta antibody (APC), anti CD3-DELTA antibody (APC), anti CD3D antibody (APC), anti CD3D antigen delta polypeptide antibody (APC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (APC), anti CD3d molecule delta antibody (APC), anti CD3d molecule delta CD3 TCR complex antibody (APC), anti CD3d molecule, delta (CD3-TCR complex) antibody (APC), anti CD3E antibody (APC), anti CD3e antigen antibody (APC), anti CD3E antigen epsilon polypeptide antibody (APC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (APC), anti CD3e molecule epsilon antibody (APC), anti CD3e molecule epsilon CD3 TCR complex antibody (APC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (APC), anti CD3epsilon antibody (APC), anti CD3G antibody (APC), anti CD3g antigen antibody (APC), anti CD3G antigen gamma polypeptide antibody (APC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (APC), anti CD3g molecule gamma antibody (APC), anti CD3g molecule gamma CD3 TCR complex antibody (APC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (APC), anti CD3H antibody (APC), anti CD3Q antibody (APC), anti CD3Z antibody (APC), anti CD3zeta antibody (APC), anti Ctg3 antibody (APC), anti IMD19 antibody (APC), anti Leu-4 antibody (APC), anti OKT3, delta chain antibody (APC), anti T cell receptor antibody (APC), anti T cell receptor T3 delta chain antibody (APC), anti T cell receptor T3 gamma chain antibody (APC), anti T cell receptor T3 zeta chain antibody (APC), anti T cell receptor zeta chain antibody (APC), anti T cell surface antigen antibody (APC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (APC), anti T cell surface glycoprotein CD3 antibody (APC), anti T cell surface glycoprotein CD3 delta chain antibody (APC), anti T cell surface glycoprotein CD3 epsilon chain antibody (APC), anti T cell surface glycoprotein CD3 gamma chain antibody (APC), anti T cell surface glycoprotein CD3 zeta chain antibody (APC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (APC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (APC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (APC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (APC), anti T-cell receptor T3 delta chain antibody (APC), anti T-cell receptor T3 gamma chain antibody (APC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (APC), anti T-cell surface glycoprotein CD3 delta chain antibody (APC), anti T-cell surface glycoprotein CD3 gamma chain antibody (APC), anti T3 antibody (APC), anti T3D antibody (APC), anti T3E antibody (APC), anti T3G antibody (APC), anti T3Z antibody (APC), anti TCRE antibody (APC), anti TCRk antibody (APC), anti TCRZ antibody (APC), anti TCRzeta antibody (APC)3600orb248712100 AssaysCD3 antibody (APC)anti CD 3 antibody (APC), anti Cd247 antibody (APC), anti CD247 antigen antibody (APC), anti CD247 antigen, zeta subunit antibody (APC), anti CD247 molecule antibody (APC), anti CD3 antibody (APC), anti CD3 antigen, delta subunit antibody (APC), anti CD3 delta antibody (APC), anti CD3 epsilon antibody (APC), anti CD3 eta antibody (APC), anti CD3 gamma antibody (APC), anti CD3 molecule delta polypeptide antibody (APC), anti CD3 molecule, epsilon polypeptide antibody (APC), anti CD3 molecule, gamma polypeptide antibody (APC), anti CD3 zeta antibody (APC), anti CD3-DELTA antibody (APC), anti CD3D antibody (APC), anti CD3D antigen delta polypeptide antibody (APC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (APC), anti CD3d molecule delta antibody (APC), anti CD3d molecule delta CD3 TCR complex antibody (APC), anti CD3d molecule, delta (CD3-TCR complex) antibody (APC), anti CD3E antibody (APC), anti CD3e antigen antibody (APC), anti CD3E antigen epsilon polypeptide antibody (APC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (APC), anti CD3e molecule epsilon antibody (APC), anti CD3e molecule epsilon CD3 TCR complex antibody (APC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (APC), anti CD3epsilon antibody (APC), anti CD3G antibody (APC), anti CD3g antigen antibody (APC), anti CD3G antigen gamma polypeptide antibody (APC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (APC), anti CD3g molecule gamma antibody (APC), anti CD3g molecule gamma CD3 TCR complex antibody (APC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (APC), anti CD3H antibody (APC), anti CD3Q antibody (APC), anti CD3Z antibody (APC), anti CD3zeta antibody (APC), anti Ctg3 antibody (APC), anti IMD19 antibody (APC), anti Leu-4 antibody (APC), anti OKT3, delta chain antibody (APC), anti T cell receptor antibody (APC), anti T cell receptor T3 delta chain antibody (APC), anti T cell receptor T3 gamma chain antibody (APC), anti T cell receptor T3 zeta chain antibody (APC), anti T cell receptor zeta chain antibody (APC), anti T cell surface antigen antibody (APC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (APC), anti T cell surface glycoprotein CD3 antibody (APC), anti T cell surface glycoprotein CD3 delta chain antibody (APC), anti T cell surface glycoprotein CD3 epsilon chain antibody (APC), anti T cell surface glycoprotein CD3 gamma chain antibody (APC), anti T cell surface glycoprotein CD3 zeta chain antibody (APC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (APC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (APC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (APC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (APC), anti T-cell receptor T3 delta chain antibody (APC), anti T-cell receptor T3 gamma chain antibody (APC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (APC), anti T-cell surface glycoprotein CD3 delta chain antibody (APC), anti T-cell surface glycoprotein CD3 gamma chain antibody (APC), anti T3 antibody (APC), anti T3D antibody (APC), anti T3E antibody (APC), anti T3G antibody (APC), anti T3Z antibody (APC), anti TCRE antibody (APC), anti TCRk antibody (APC), anti TCRZ antibody (APC), anti TCRzeta antibody (APC)4770orb1192550 TestsCD3 antibody (APC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970orb11925100 TestsCD3 antibody (APC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4050orb443390.1 mgCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)4770orb1798720.1 mgCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)3060"Mouse BM10-37 cytotoxic T lymphocytes "orb2228270.1 mgCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)4770human thymocytes followed by Sezary T cellsorb263300.2 mgCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)6804orb11927100 ugCD3 antibody (Biotin)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970orb11927500 ugCD3 antibody (Biotin)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6570orb114024100 ulCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)3870Synthetic peptide (Please contact us for more details)orb198072100 TestsCD3 antibody (Biotin)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4140CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb308421100 TestsCD3 antibody (Biotin)anti CD3 antibody3780PHA activated T cellsorb31526450 ugCD3 antibody (Biotin)7560orb24870050 AssaysCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)3600orb248700100 AssaysCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)4770orb22640500 ugCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)5940Purified human PBL cells.orb226401 mgCD3 antibody (Biotin)anti CD 3 antibody (Biotin), anti Cd247 antibody (Biotin), anti CD247 antigen antibody (Biotin), anti CD247 antigen, zeta subunit antibody (Biotin), anti CD247 molecule antibody (Biotin), anti CD3 antibody (Biotin), anti CD3 antigen, delta subunit antibody (Biotin), anti CD3 delta antibody (Biotin), anti CD3 epsilon antibody (Biotin), anti CD3 eta antibody (Biotin), anti CD3 gamma antibody (Biotin), anti CD3 molecule delta polypeptide antibody (Biotin), anti CD3 molecule, epsilon polypeptide antibody (Biotin), anti CD3 molecule, gamma polypeptide antibody (Biotin), anti CD3 zeta antibody (Biotin), anti CD3-DELTA antibody (Biotin), anti CD3D antibody (Biotin), anti CD3D antigen delta polypeptide antibody (Biotin), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Biotin), anti CD3d molecule delta antibody (Biotin), anti CD3d molecule delta CD3 TCR complex antibody (Biotin), anti CD3d molecule, delta (CD3-TCR complex) antibody (Biotin), anti CD3E antibody (Biotin), anti CD3e antigen antibody (Biotin), anti CD3E antigen epsilon polypeptide antibody (Biotin), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Biotin), anti CD3e molecule epsilon antibody (Biotin), anti CD3e molecule epsilon CD3 TCR complex antibody (Biotin), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Biotin), anti CD3epsilon antibody (Biotin), anti CD3G antibody (Biotin), anti CD3g antigen antibody (Biotin), anti CD3G antigen gamma polypeptide antibody (Biotin), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Biotin), anti CD3g molecule gamma antibody (Biotin), anti CD3g molecule gamma CD3 TCR complex antibody (Biotin), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Biotin), anti CD3H antibody (Biotin), anti CD3Q antibody (Biotin), anti CD3Z antibody (Biotin), anti CD3zeta antibody (Biotin), anti Ctg3 antibody (Biotin), anti IMD19 antibody (Biotin), anti Leu-4 antibody (Biotin), anti OKT3, delta chain antibody (Biotin), anti T cell receptor antibody (Biotin), anti T cell receptor T3 delta chain antibody (Biotin), anti T cell receptor T3 gamma chain antibody (Biotin), anti T cell receptor T3 zeta chain antibody (Biotin), anti T cell receptor zeta chain antibody (Biotin), anti T cell surface antigen antibody (Biotin), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 antibody (Biotin), anti T cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T cell surface glycoprotein CD3 epsilon chain antibody (Biotin), anti T cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T cell surface glycoprotein CD3 zeta chain antibody (Biotin), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Biotin), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Biotin), anti T-cell receptor T3 delta chain antibody (Biotin), anti T-cell receptor T3 gamma chain antibody (Biotin), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Biotin), anti T-cell surface glycoprotein CD3 delta chain antibody (Biotin), anti T-cell surface glycoprotein CD3 gamma chain antibody (Biotin), anti T3 antibody (Biotin), anti T3D antibody (Biotin), anti T3E antibody (Biotin), anti T3G antibody (Biotin), anti T3Z antibody (Biotin), anti TCRE antibody (Biotin), anti TCRk antibody (Biotin), anti TCRZ antibody (Biotin), anti TCRzeta antibody (Biotin)7020Purified human PBL cells.orb114516100 ulCD3 antibody (Cy3)anti CD 3 antibody (Cy3), anti Cd247 antibody (Cy3), anti CD247 antigen antibody (Cy3), anti CD247 antigen, zeta subunit antibody (Cy3), anti CD247 molecule antibody (Cy3), anti CD3 antibody (Cy3), anti CD3 antigen, delta subunit antibody (Cy3), anti CD3 delta antibody (Cy3), anti CD3 epsilon antibody (Cy3), anti CD3 eta antibody (Cy3), anti CD3 gamma antibody (Cy3), anti CD3 molecule delta polypeptide antibody (Cy3), anti CD3 molecule, epsilon polypeptide antibody (Cy3), anti CD3 molecule, gamma polypeptide antibody (Cy3), anti CD3 zeta antibody (Cy3), anti CD3-DELTA antibody (Cy3), anti CD3D antibody (Cy3), anti CD3D antigen delta polypeptide antibody (Cy3), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Cy3), anti CD3d molecule delta antibody (Cy3), anti CD3d molecule delta CD3 TCR complex antibody (Cy3), anti CD3d molecule, delta (CD3-TCR complex) antibody (Cy3), anti CD3E antibody (Cy3), anti CD3e antigen antibody (Cy3), anti CD3E antigen epsilon polypeptide antibody (Cy3), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Cy3), anti CD3e molecule epsilon antibody (Cy3), anti CD3e molecule epsilon CD3 TCR complex antibody (Cy3), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Cy3), anti CD3epsilon antibody (Cy3), anti CD3G antibody (Cy3), anti CD3g antigen antibody (Cy3), anti CD3G antigen gamma polypeptide antibody (Cy3), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Cy3), anti CD3g molecule gamma antibody (Cy3), anti CD3g molecule gamma CD3 TCR complex antibody (Cy3), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Cy3), anti CD3H antibody (Cy3), anti CD3Q antibody (Cy3), anti CD3Z antibody (Cy3), anti CD3zeta antibody (Cy3), anti Ctg3 antibody (Cy3), anti IMD19 antibody (Cy3), anti Leu-4 antibody (Cy3), anti OKT3, delta chain antibody (Cy3), anti T cell receptor antibody (Cy3), anti T cell receptor T3 delta chain antibody (Cy3), anti T cell receptor T3 gamma chain antibody (Cy3), anti T cell receptor T3 zeta chain antibody (Cy3), anti T cell receptor zeta chain antibody (Cy3), anti T cell surface antigen antibody (Cy3), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Cy3), anti T cell surface glycoprotein CD3 antibody (Cy3), anti T cell surface glycoprotein CD3 delta chain antibody (Cy3), anti T cell surface glycoprotein CD3 epsilon chain antibody (Cy3), anti T cell surface glycoprotein CD3 gamma chain antibody (Cy3), anti T cell surface glycoprotein CD3 zeta chain antibody (Cy3), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Cy3), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Cy3), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Cy3), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Cy3), anti T-cell receptor T3 delta chain antibody (Cy3), anti T-cell receptor T3 gamma chain antibody (Cy3), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Cy3), anti T-cell surface glycoprotein CD3 delta chain antibody (Cy3), anti T-cell surface glycoprotein CD3 gamma chain antibody (Cy3), anti T3 antibody (Cy3), anti T3D antibody (Cy3), anti T3E antibody (Cy3), anti T3G antibody (Cy3), anti T3Z antibody (Cy3), anti TCRE antibody (Cy3), anti TCRk antibody (Cy3), anti TCRZ antibody (Cy3), anti TCRzeta antibody (Cy3)3870Synthetic peptide (Please contact us for more details)orb122466100 ulCD3 antibody (Cy5)anti CD 3 antibody (Cy5), anti Cd247 antibody (Cy5), anti CD247 antigen antibody (Cy5), anti CD247 antigen, zeta subunit antibody (Cy5), anti CD247 molecule antibody (Cy5), anti CD3 antibody (Cy5), anti CD3 antigen, delta subunit antibody (Cy5), anti CD3 delta antibody (Cy5), anti CD3 epsilon antibody (Cy5), anti CD3 eta antibody (Cy5), anti CD3 gamma antibody (Cy5), anti CD3 molecule delta polypeptide antibody (Cy5), anti CD3 molecule, epsilon polypeptide antibody (Cy5), anti CD3 molecule, gamma polypeptide antibody (Cy5), anti CD3 zeta antibody (Cy5), anti CD3-DELTA antibody (Cy5), anti CD3D antibody (Cy5), anti CD3D antigen delta polypeptide antibody (Cy5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Cy5), anti CD3d molecule delta antibody (Cy5), anti CD3d molecule delta CD3 TCR complex antibody (Cy5), anti CD3d molecule, delta (CD3-TCR complex) antibody (Cy5), anti CD3E antibody (Cy5), anti CD3e antigen antibody (Cy5), anti CD3E antigen epsilon polypeptide antibody (Cy5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Cy5), anti CD3e molecule epsilon antibody (Cy5), anti CD3e molecule epsilon CD3 TCR complex antibody (Cy5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Cy5), anti CD3epsilon antibody (Cy5), anti CD3G antibody (Cy5), anti CD3g antigen antibody (Cy5), anti CD3G antigen gamma polypeptide antibody (Cy5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Cy5), anti CD3g molecule gamma antibody (Cy5), anti CD3g molecule gamma CD3 TCR complex antibody (Cy5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Cy5), anti CD3H antibody (Cy5), anti CD3Q antibody (Cy5), anti CD3Z antibody (Cy5), anti CD3zeta antibody (Cy5), anti Ctg3 antibody (Cy5), anti IMD19 antibody (Cy5), anti Leu-4 antibody (Cy5), anti OKT3, delta chain antibody (Cy5), anti T cell receptor antibody (Cy5), anti T cell receptor T3 delta chain antibody (Cy5), anti T cell receptor T3 gamma chain antibody (Cy5), anti T cell receptor T3 zeta chain antibody (Cy5), anti T cell receptor zeta chain antibody (Cy5), anti T cell surface antigen antibody (Cy5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Cy5), anti T cell surface glycoprotein CD3 antibody (Cy5), anti T cell surface glycoprotein CD3 delta chain antibody (Cy5), anti T cell surface glycoprotein CD3 epsilon chain antibody (Cy5), anti T cell surface glycoprotein CD3 gamma chain antibody (Cy5), anti T cell surface glycoprotein CD3 zeta chain antibody (Cy5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Cy5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Cy5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Cy5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Cy5), anti T-cell receptor T3 delta chain antibody (Cy5), anti T-cell receptor T3 gamma chain antibody (Cy5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Cy5), anti T-cell surface glycoprotein CD3 delta chain antibody (Cy5), anti T-cell surface glycoprotein CD3 gamma chain antibody (Cy5), anti T3 antibody (Cy5), anti T3D antibody (Cy5), anti T3E antibody (Cy5), anti T3G antibody (Cy5), anti T3Z antibody (Cy5), anti TCRE antibody (Cy5), anti TCRk antibody (Cy5), anti TCRZ antibody (Cy5), anti TCRzeta antibody (Cy5)3870Synthetic peptide (Please contact us for more details)orb31526650 ugCD3 antibody (Cy5)7560orb123049100 ulCD3 antibody (Cy5.5)anti CD 3 antibody (Cy5.5), anti Cd247 antibody (Cy5.5), anti CD247 antigen antibody (Cy5.5), anti CD247 antigen, zeta subunit antibody (Cy5.5), anti CD247 molecule antibody (Cy5.5), anti CD3 antibody (Cy5.5), anti CD3 antigen, delta subunit antibody (Cy5.5), anti CD3 delta antibody (Cy5.5), anti CD3 epsilon antibody (Cy5.5), anti CD3 eta antibody (Cy5.5), anti CD3 gamma antibody (Cy5.5), anti CD3 molecule delta polypeptide antibody (Cy5.5), anti CD3 molecule, epsilon polypeptide antibody (Cy5.5), anti CD3 molecule, gamma polypeptide antibody (Cy5.5), anti CD3 zeta antibody (Cy5.5), anti CD3-DELTA antibody (Cy5.5), anti CD3D antibody (Cy5.5), anti CD3D antigen delta polypeptide antibody (Cy5.5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Cy5.5), anti CD3d molecule delta antibody (Cy5.5), anti CD3d molecule delta CD3 TCR complex antibody (Cy5.5), anti CD3d molecule, delta (CD3-TCR complex) antibody (Cy5.5), anti CD3E antibody (Cy5.5), anti CD3e antigen antibody (Cy5.5), anti CD3E antigen epsilon polypeptide antibody (Cy5.5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Cy5.5), anti CD3e molecule epsilon antibody (Cy5.5), anti CD3e molecule epsilon CD3 TCR complex antibody (Cy5.5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Cy5.5), anti CD3epsilon antibody (Cy5.5), anti CD3G antibody (Cy5.5), anti CD3g antigen antibody (Cy5.5), anti CD3G antigen gamma polypeptide antibody (Cy5.5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Cy5.5), anti CD3g molecule gamma antibody (Cy5.5), anti CD3g molecule gamma CD3 TCR complex antibody (Cy5.5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Cy5.5), anti CD3H antibody (Cy5.5), anti CD3Q antibody (Cy5.5), anti CD3Z antibody (Cy5.5), anti CD3zeta antibody (Cy5.5), anti Ctg3 antibody (Cy5.5), anti IMD19 antibody (Cy5.5), anti Leu-4 antibody (Cy5.5), anti OKT3, delta chain antibody (Cy5.5), anti T cell receptor antibody (Cy5.5), anti T cell receptor T3 delta chain antibody (Cy5.5), anti T cell receptor T3 gamma chain antibody (Cy5.5), anti T cell receptor T3 zeta chain antibody (Cy5.5), anti T cell receptor zeta chain antibody (Cy5.5), anti T cell surface antigen antibody (Cy5.5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Cy5.5), anti T cell surface glycoprotein CD3 antibody (Cy5.5), anti T cell surface glycoprotein CD3 delta chain antibody (Cy5.5), anti T cell surface glycoprotein CD3 epsilon chain antibody (Cy5.5), anti T cell surface glycoprotein CD3 gamma chain antibody (Cy5.5), anti T cell surface glycoprotein CD3 zeta chain antibody (Cy5.5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Cy5.5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Cy5.5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Cy5.5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Cy5.5), anti T-cell receptor T3 delta chain antibody (Cy5.5), anti T-cell receptor T3 gamma chain antibody (Cy5.5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Cy5.5), anti T-cell surface glycoprotein CD3 delta chain antibody (Cy5.5), anti T-cell surface glycoprotein CD3 gamma chain antibody (Cy5.5), anti T3 antibody (Cy5.5), anti T3D antibody (Cy5.5), anti T3E antibody (Cy5.5), anti T3G antibody (Cy5.5), anti T3Z antibody (Cy5.5), anti TCRE antibody (Cy5.5), anti TCRk antibody (Cy5.5), anti TCRZ antibody (Cy5.5), anti TCRzeta antibody (Cy5.5)3870Synthetic peptide (Please contact us for more details)orb123541100 ulCD3 antibody (Cy7)anti CD 3 antibody (Cy7), anti Cd247 antibody (Cy7), anti CD247 antigen antibody (Cy7), anti CD247 antigen, zeta subunit antibody (Cy7), anti CD247 molecule antibody (Cy7), anti CD3 antibody (Cy7), anti CD3 antigen, delta subunit antibody (Cy7), anti CD3 delta antibody (Cy7), anti CD3 epsilon antibody (Cy7), anti CD3 eta antibody (Cy7), anti CD3 gamma antibody (Cy7), anti CD3 molecule delta polypeptide antibody (Cy7), anti CD3 molecule, epsilon polypeptide antibody (Cy7), anti CD3 molecule, gamma polypeptide antibody (Cy7), anti CD3 zeta antibody (Cy7), anti CD3-DELTA antibody (Cy7), anti CD3D antibody (Cy7), anti CD3D antigen delta polypeptide antibody (Cy7), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (Cy7), anti CD3d molecule delta antibody (Cy7), anti CD3d molecule delta CD3 TCR complex antibody (Cy7), anti CD3d molecule, delta (CD3-TCR complex) antibody (Cy7), anti CD3E antibody (Cy7), anti CD3e antigen antibody (Cy7), anti CD3E antigen epsilon polypeptide antibody (Cy7), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (Cy7), anti CD3e molecule epsilon antibody (Cy7), anti CD3e molecule epsilon CD3 TCR complex antibody (Cy7), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (Cy7), anti CD3epsilon antibody (Cy7), anti CD3G antibody (Cy7), anti CD3g antigen antibody (Cy7), anti CD3G antigen gamma polypeptide antibody (Cy7), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (Cy7), anti CD3g molecule gamma antibody (Cy7), anti CD3g molecule gamma CD3 TCR complex antibody (Cy7), anti CD3g molecule, gamma (CD3-TCR complex) antibody (Cy7), anti CD3H antibody (Cy7), anti CD3Q antibody (Cy7), anti CD3Z antibody (Cy7), anti CD3zeta antibody (Cy7), anti Ctg3 antibody (Cy7), anti IMD19 antibody (Cy7), anti Leu-4 antibody (Cy7), anti OKT3, delta chain antibody (Cy7), anti T cell receptor antibody (Cy7), anti T cell receptor T3 delta chain antibody (Cy7), anti T cell receptor T3 gamma chain antibody (Cy7), anti T cell receptor T3 zeta chain antibody (Cy7), anti T cell receptor zeta chain antibody (Cy7), anti T cell surface antigen antibody (Cy7), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (Cy7), anti T cell surface glycoprotein CD3 antibody (Cy7), anti T cell surface glycoprotein CD3 delta chain antibody (Cy7), anti T cell surface glycoprotein CD3 epsilon chain antibody (Cy7), anti T cell surface glycoprotein CD3 gamma chain antibody (Cy7), anti T cell surface glycoprotein CD3 zeta chain antibody (Cy7), anti T-cell antigen receptor complex, delta subunit of T3 antibody (Cy7), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (Cy7), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (Cy7), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (Cy7), anti T-cell receptor T3 delta chain antibody (Cy7), anti T-cell receptor T3 gamma chain antibody (Cy7), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (Cy7), anti T-cell surface glycoprotein CD3 delta chain antibody (Cy7), anti T-cell surface glycoprotein CD3 gamma chain antibody (Cy7), anti T3 antibody (Cy7), anti T3D antibody (Cy7), anti T3E antibody (Cy7), anti T3G antibody (Cy7), anti T3Z antibody (Cy7), anti TCRE antibody (Cy7), anti TCRk antibody (Cy7), anti TCRZ antibody (Cy7), anti TCRzeta antibody (Cy7)3870Synthetic peptide (Please contact us for more details)orb154541100 TestsCD3 antibody (DyLight 594)anti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody6300Human thymocytes and T lymphocytes.orb445940.1 mgCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3870orb15273100 ugCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3870Synthetic peptide (please contact us for details)orb15307100 ugCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3870Synthetic peptide (please contact us for details)orb16254100 ugCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3870Synthetic peptide (please contact us for details)orb360904100 ugCD3 antibody (FITC)anti-4930549J05Rik antibody, anti-A430104F18Rik antibody, anti-AW552088 antibody, anti-Cd247 antibody, anti-CD247 antigen antibody, anti-CD247 antigen, zeta subunit antibody, anti-CD247 molecule antibody, anti-CD3 antibody, anti-CD3 antigen, delta subunit antibody, anti-CD3 delta antibody, anti-CD3 epsilon antibody, anti-CD3 eta antibody, anti-CD3 gamma antibody, anti-CD3 molecule delta polypeptide antibody, anti-CD3 molecule, epsilon polypeptide antibody, anti-CD3 molecule, gamma polypeptide antibody, anti-CD3 zeta antibody, anti-CD3-DELTA antibody, anti-CD3d antibody, anti-CD3D antigen delta polypeptide antibody, anti-CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti-CD3d molecule delta antibody, anti-CD3d molecule delta CD3 TCR complex antibody, anti-CD3d molecule, anti-CD3D_HUMAN antibody, anti-CD3E antibody, anti-CD3e antigen antibody, anti-CD3E antigen epsilon polypeptide antibody, anti-CD3e antigen, anti-CD3e molecule epsilon antibody, anti-CD3e molecule epsilon CD3 TCR complex antibody, anti-CD3e molecule,, anti-CD3epsilon antibody, anti-CD3G antibody, anti-CD3g antigen antibody, anti-CD3G antigen gamma polypeptide antibody, anti-CD3g antigen, anti-CD3g molecule gamma antibody, anti-CD3g molecule gamma CD3 TCR complex antibody, anti-CD3g molecule, anti-CD3H antibody, anti-CD3Q antibody, anti-CD3Z antibody, anti-CD3zeta antibody, anti-Ctg3 antibody, anti-FLJ17620 antibody, anti-FLJ17664 antibody, anti-FLJ18683 antibody, anti-FLJ79544 antibody, anti-FLJ94613 antibody, anti-IMD19 antibody, anti-Leu-4 antibody, anti-MGC138597 antibody, anti-OKT3, delta chain antibody, anti-T cell receptor antibody, anti-T cell receptor T3 delta chain antibody, anti-T cell receptor T3 gamma chain antibody, anti-T cell receptor T3 zeta chain antibody, anti-T cell receptor zeta chain antibody, anti-T cell surface glycoprotein CD3 antibody, anti-T cell surface glycoprotein CD3 delta chain antibody, anti-T cell surface glycoprotein CD3 epsilon chain antibody, anti-T cell surface glycoprotein CD3 gamma chain antibody, anti-T cell surface glycoprotein CD3 zeta chain antibody, anti-T-cell antigen receptor complex, delta subunit of T3 antibody, anti-T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti-T-cell antigen receptor complex, gamma subunit of T3 antibody, anti-T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti-T-cell receptor T3 delta chain antibody, anti-T-cell receptor T3 gamma chain antibody, anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti-T-cell surface glycoprotein CD3 delta chain antibody, anti-T-cell surface glycoprotein CD3 gamma chain antibody, anti-T3 antibody, anti-T3d antibody, anti-T3e antibody, anti-T3g antibody, anti-T3z antibody, anti-TCRE antibody, anti-TCRk antibody, anti-Tcrz antibody, anti-TCRzeta antibody3330Synthetic peptide (please contact us for details)orb44340100 testsCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)4770orb44561100 testsCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)4770orb198071100 TestsCD3 antibody (FITC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4140CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb301781100 TestsCD3 antibody (FITC)7110orb308685100 TestsCD3 antibody (FITC)anti CD3 antibody3780PHA activated T cellsorb3897982 ml (100 Tests)CD3 antibody (FITC)6300orb31526550 ugCD3 antibody (FITC)7560orb22366950 ulCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)5850Human infant thymocytes and Sezary cells.orb24874650 AssaysCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3600orb248746100 AssaysCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)4770orb24874850 AssaysCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)3600orb248748100 AssaysCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)4770orb1192250 TestsCD3 antibody (FITC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970orb11922100 TestsCD3 antibody (FITC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870orb22639500 ugCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)5940Purified human PBL cells.orb226391 mgCD3 antibody (FITC)anti CD 3 antibody (FITC), anti Cd247 antibody (FITC), anti CD247 antigen antibody (FITC), anti CD247 antigen, zeta subunit antibody (FITC), anti CD247 molecule antibody (FITC), anti CD3 antibody (FITC), anti CD3 antigen, delta subunit antibody (FITC), anti CD3 delta antibody (FITC), anti CD3 epsilon antibody (FITC), anti CD3 eta antibody (FITC), anti CD3 gamma antibody (FITC), anti CD3 molecule delta polypeptide antibody (FITC), anti CD3 molecule, epsilon polypeptide antibody (FITC), anti CD3 molecule, gamma polypeptide antibody (FITC), anti CD3 zeta antibody (FITC), anti CD3-DELTA antibody (FITC), anti CD3D antibody (FITC), anti CD3D antigen delta polypeptide antibody (FITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (FITC), anti CD3d molecule delta antibody (FITC), anti CD3d molecule delta CD3 TCR complex antibody (FITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (FITC), anti CD3E antibody (FITC), anti CD3e antigen antibody (FITC), anti CD3E antigen epsilon polypeptide antibody (FITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (FITC), anti CD3e molecule epsilon antibody (FITC), anti CD3e molecule epsilon CD3 TCR complex antibody (FITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (FITC), anti CD3epsilon antibody (FITC), anti CD3G antibody (FITC), anti CD3g antigen antibody (FITC), anti CD3G antigen gamma polypeptide antibody (FITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (FITC), anti CD3g molecule gamma antibody (FITC), anti CD3g molecule gamma CD3 TCR complex antibody (FITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (FITC), anti CD3H antibody (FITC), anti CD3Q antibody (FITC), anti CD3Z antibody (FITC), anti CD3zeta antibody (FITC), anti Ctg3 antibody (FITC), anti IMD19 antibody (FITC), anti Leu-4 antibody (FITC), anti OKT3, delta chain antibody (FITC), anti T cell receptor antibody (FITC), anti T cell receptor T3 delta chain antibody (FITC), anti T cell receptor T3 gamma chain antibody (FITC), anti T cell receptor T3 zeta chain antibody (FITC), anti T cell receptor zeta chain antibody (FITC), anti T cell surface antigen antibody (FITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 antibody (FITC), anti T cell surface glycoprotein CD3 delta chain antibody (FITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (FITC), anti T cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T cell surface glycoprotein CD3 zeta chain antibody (FITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (FITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (FITC), anti T-cell receptor T3 delta chain antibody (FITC), anti T-cell receptor T3 gamma chain antibody (FITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (FITC), anti T-cell surface glycoprotein CD3 delta chain antibody (FITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (FITC), anti T3 antibody (FITC), anti T3D antibody (FITC), anti T3E antibody (FITC), anti T3G antibody (FITC), anti T3Z antibody (FITC), anti TCRE antibody (FITC), anti TCRk antibody (FITC), anti TCRZ antibody (FITC), anti TCRzeta antibody (FITC)7020Purified human PBL cells.orb110084100 ulCD3 antibody (HRP)anti CD 3 antibody (HRP), anti Cd247 antibody (HRP), anti CD247 antigen antibody (HRP), anti CD247 antigen, zeta subunit antibody (HRP), anti CD247 molecule antibody (HRP), anti CD3 antibody (HRP), anti CD3 antigen, delta subunit antibody (HRP), anti CD3 delta antibody (HRP), anti CD3 epsilon antibody (HRP), anti CD3 eta antibody (HRP), anti CD3 gamma antibody (HRP), anti CD3 molecule delta polypeptide antibody (HRP), anti CD3 molecule, epsilon polypeptide antibody (HRP), anti CD3 molecule, gamma polypeptide antibody (HRP), anti CD3 zeta antibody (HRP), anti CD3-DELTA antibody (HRP), anti CD3D antibody (HRP), anti CD3D antigen delta polypeptide antibody (HRP), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (HRP), anti CD3d molecule delta antibody (HRP), anti CD3d molecule delta CD3 TCR complex antibody (HRP), anti CD3d molecule, delta (CD3-TCR complex) antibody (HRP), anti CD3E antibody (HRP), anti CD3e antigen antibody (HRP), anti CD3E antigen epsilon polypeptide antibody (HRP), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (HRP), anti CD3e molecule epsilon antibody (HRP), anti CD3e molecule epsilon CD3 TCR complex antibody (HRP), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (HRP), anti CD3epsilon antibody (HRP), anti CD3G antibody (HRP), anti CD3g antigen antibody (HRP), anti CD3G antigen gamma polypeptide antibody (HRP), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (HRP), anti CD3g molecule gamma antibody (HRP), anti CD3g molecule gamma CD3 TCR complex antibody (HRP), anti CD3g molecule, gamma (CD3-TCR complex) antibody (HRP), anti CD3H antibody (HRP), anti CD3Q antibody (HRP), anti CD3Z antibody (HRP), anti CD3zeta antibody (HRP), anti Ctg3 antibody (HRP), anti IMD19 antibody (HRP), anti Leu-4 antibody (HRP), anti OKT3, delta chain antibody (HRP), anti T cell receptor antibody (HRP), anti T cell receptor T3 delta chain antibody (HRP), anti T cell receptor T3 gamma chain antibody (HRP), anti T cell receptor T3 zeta chain antibody (HRP), anti T cell receptor zeta chain antibody (HRP), anti T cell surface antigen antibody (HRP), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (HRP), anti T cell surface glycoprotein CD3 antibody (HRP), anti T cell surface glycoprotein CD3 delta chain antibody (HRP), anti T cell surface glycoprotein CD3 epsilon chain antibody (HRP), anti T cell surface glycoprotein CD3 gamma chain antibody (HRP), anti T cell surface glycoprotein CD3 zeta chain antibody (HRP), anti T-cell antigen receptor complex, delta subunit of T3 antibody (HRP), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (HRP), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (HRP), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (HRP), anti T-cell receptor T3 delta chain antibody (HRP), anti T-cell receptor T3 gamma chain antibody (HRP), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (HRP), anti T-cell surface glycoprotein CD3 delta chain antibody (HRP), anti T-cell surface glycoprotein CD3 gamma chain antibody (HRP), anti T3 antibody (HRP), anti T3D antibody (HRP), anti T3E antibody (HRP), anti T3G antibody (HRP), anti T3Z antibody (HRP), anti TCRE antibody (HRP), anti TCRk antibody (HRP), anti TCRZ antibody (HRP), anti TCRzeta antibody (HRP)3870Synthetic peptide (Please contact us for more details)orb446800.1 mgCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)5670orb1798730.1 mgCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)4140"Mouse BM10-37 cytotoxic T lymphocytes "orb124525100 ulCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)3870Synthetic peptide (Please contact us for more details)orb44341100 testsCD3 antibody (PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody5670orb44562100 testsCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)5670orb198127100 TestsCD3 antibody (PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb198228100 TestsCD3 antibody (PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody5040CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD5: Derived from the hybridization of mouse NS-1/Ag4 myeloma cells with spleen cells of BALB/c mice immunized with human torb301782100 TestsCD3 antibody (PE)8550orb308686100 TestsCD3 antibody (PE)anti CD3 antibody4230PHA activated T cellsorb389782100 testsCD3 antibody (PE)5670Human thymocytesorb1800432 ml (100 Tests)CD3 antibody (PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6120orb24881850 AssaysCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)3600orb248818100 AssaysCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)4770orb24882050 AssaysCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)4050orb248820100 AssaysCD3 antibody (PE)anti CD 3 antibody (PE), anti Cd247 antibody (PE), anti CD247 antigen antibody (PE), anti CD247 antigen, zeta subunit antibody (PE), anti CD247 molecule antibody (PE), anti CD3 antibody (PE), anti CD3 antigen, delta subunit antibody (PE), anti CD3 delta antibody (PE), anti CD3 epsilon antibody (PE), anti CD3 eta antibody (PE), anti CD3 gamma antibody (PE), anti CD3 molecule delta polypeptide antibody (PE), anti CD3 molecule, epsilon polypeptide antibody (PE), anti CD3 molecule, gamma polypeptide antibody (PE), anti CD3 zeta antibody (PE), anti CD3-DELTA antibody (PE), anti CD3D antibody (PE), anti CD3D antigen delta polypeptide antibody (PE), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE), anti CD3d molecule delta antibody (PE), anti CD3d molecule delta CD3 TCR complex antibody (PE), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE), anti CD3E antibody (PE), anti CD3e antigen antibody (PE), anti CD3E antigen epsilon polypeptide antibody (PE), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE), anti CD3e molecule epsilon antibody (PE), anti CD3e molecule epsilon CD3 TCR complex antibody (PE), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE), anti CD3epsilon antibody (PE), anti CD3G antibody (PE), anti CD3g antigen antibody (PE), anti CD3G antigen gamma polypeptide antibody (PE), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE), anti CD3g molecule gamma antibody (PE), anti CD3g molecule gamma CD3 TCR complex antibody (PE), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE), anti CD3H antibody (PE), anti CD3Q antibody (PE), anti CD3Z antibody (PE), anti CD3zeta antibody (PE), anti Ctg3 antibody (PE), anti IMD19 antibody (PE), anti Leu-4 antibody (PE), anti OKT3, delta chain antibody (PE), anti T cell receptor antibody (PE), anti T cell receptor T3 delta chain antibody (PE), anti T cell receptor T3 gamma chain antibody (PE), anti T cell receptor T3 zeta chain antibody (PE), anti T cell receptor zeta chain antibody (PE), anti T cell surface antigen antibody (PE), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 antibody (PE), anti T cell surface glycoprotein CD3 delta chain antibody (PE), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE), anti T cell surface glycoprotein CD3 gamma chain antibody (PE), anti T cell surface glycoprotein CD3 zeta chain antibody (PE), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE), anti T-cell receptor T3 delta chain antibody (PE), anti T-cell receptor T3 gamma chain antibody (PE), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE), anti T-cell surface glycoprotein CD3 delta chain antibody (PE), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE), anti T3 antibody (PE), anti T3D antibody (PE), anti T3E antibody (PE), anti T3G antibody (PE), anti T3Z antibody (PE), anti TCRE antibody (PE), anti TCRk antibody (PE), anti TCRZ antibody (PE), anti TCRzeta antibody (PE)5940orb1192350 TestsCD3 antibody (PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970orb11923100 TestsCD3 antibody (PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4050orb129046100 ulCD3 antibody (PE-Cy3)anti CD 3 antibody (PE-Cy3), anti Cd247 antibody (PE-Cy3), anti CD247 antigen antibody (PE-Cy3), anti CD247 antigen, zeta subunit antibody (PE-Cy3), anti CD247 molecule antibody (PE-Cy3), anti CD3 antibody (PE-Cy3), anti CD3 antigen, delta subunit antibody (PE-Cy3), anti CD3 delta antibody (PE-Cy3), anti CD3 epsilon antibody (PE-Cy3), anti CD3 eta antibody (PE-Cy3), anti CD3 gamma antibody (PE-Cy3), anti CD3 molecule delta polypeptide antibody (PE-Cy3), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy3), anti CD3 molecule, gamma polypeptide antibody (PE-Cy3), anti CD3 zeta antibody (PE-Cy3), anti CD3-DELTA antibody (PE-Cy3), anti CD3D antibody (PE-Cy3), anti CD3D antigen delta polypeptide antibody (PE-Cy3), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy3), anti CD3d molecule delta antibody (PE-Cy3), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy3), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy3), anti CD3E antibody (PE-Cy3), anti CD3e antigen antibody (PE-Cy3), anti CD3E antigen epsilon polypeptide antibody (PE-Cy3), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy3), anti CD3e molecule epsilon antibody (PE-Cy3), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy3), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy3), anti CD3epsilon antibody (PE-Cy3), anti CD3G antibody (PE-Cy3), anti CD3g antigen antibody (PE-Cy3), anti CD3G antigen gamma polypeptide antibody (PE-Cy3), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy3), anti CD3g molecule gamma antibody (PE-Cy3), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy3), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy3), anti CD3H antibody (PE-Cy3), anti CD3Q antibody (PE-Cy3), anti CD3Z antibody (PE-Cy3), anti CD3zeta antibody (PE-Cy3), anti Ctg3 antibody (PE-Cy3), anti IMD19 antibody (PE-Cy3), anti Leu-4 antibody (PE-Cy3), anti OKT3, delta chain antibody (PE-Cy3), anti T cell receptor antibody (PE-Cy3), anti T cell receptor T3 delta chain antibody (PE-Cy3), anti T cell receptor T3 gamma chain antibody (PE-Cy3), anti T cell receptor T3 zeta chain antibody (PE-Cy3), anti T cell receptor zeta chain antibody (PE-Cy3), anti T cell surface antigen antibody (PE-Cy3), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy3), anti T cell surface glycoprotein CD3 antibody (PE-Cy3), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy3), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy3), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy3), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy3), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy3), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy3), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy3), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy3), anti T-cell receptor T3 delta chain antibody (PE-Cy3), anti T-cell receptor T3 gamma chain antibody (PE-Cy3), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy3), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy3), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy3), anti T3 antibody (PE-Cy3), anti T3D antibody (PE-Cy3), anti T3E antibody (PE-Cy3), anti T3G antibody (PE-Cy3), anti T3Z antibody (PE-Cy3), anti TCRE antibody (PE-Cy3), anti TCRk antibody (PE-Cy3), anti TCRZ antibody (PE-Cy3), anti TCRzeta antibody (PE-Cy3)3870Synthetic peptide (Please contact us for more details)orb129804100 ulCD3 antibody (PE-Cy5)anti CD 3 antibody (PE-Cy5), anti Cd247 antibody (PE-Cy5), anti CD247 antigen antibody (PE-Cy5), anti CD247 antigen, zeta subunit antibody (PE-Cy5), anti CD247 molecule antibody (PE-Cy5), anti CD3 antibody (PE-Cy5), anti CD3 antigen, delta subunit antibody (PE-Cy5), anti CD3 delta antibody (PE-Cy5), anti CD3 epsilon antibody (PE-Cy5), anti CD3 eta antibody (PE-Cy5), anti CD3 gamma antibody (PE-Cy5), anti CD3 molecule delta polypeptide antibody (PE-Cy5), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy5), anti CD3 molecule, gamma polypeptide antibody (PE-Cy5), anti CD3 zeta antibody (PE-Cy5), anti CD3-DELTA antibody (PE-Cy5), anti CD3D antibody (PE-Cy5), anti CD3D antigen delta polypeptide antibody (PE-Cy5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3d molecule delta antibody (PE-Cy5), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy5), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy5), anti CD3E antibody (PE-Cy5), anti CD3e antigen antibody (PE-Cy5), anti CD3E antigen epsilon polypeptide antibody (PE-Cy5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3e molecule epsilon antibody (PE-Cy5), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy5), anti CD3epsilon antibody (PE-Cy5), anti CD3G antibody (PE-Cy5), anti CD3g antigen antibody (PE-Cy5), anti CD3G antigen gamma polypeptide antibody (PE-Cy5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3g molecule gamma antibody (PE-Cy5), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy5), anti CD3H antibody (PE-Cy5), anti CD3Q antibody (PE-Cy5), anti CD3Z antibody (PE-Cy5), anti CD3zeta antibody (PE-Cy5), anti Ctg3 antibody (PE-Cy5), anti IMD19 antibody (PE-Cy5), anti Leu-4 antibody (PE-Cy5), anti OKT3, delta chain antibody (PE-Cy5), anti T cell receptor antibody (PE-Cy5), anti T cell receptor T3 delta chain antibody (PE-Cy5), anti T cell receptor T3 gamma chain antibody (PE-Cy5), anti T cell receptor T3 zeta chain antibody (PE-Cy5), anti T cell receptor zeta chain antibody (PE-Cy5), anti T cell surface antigen antibody (PE-Cy5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 antibody (PE-Cy5), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy5), anti T-cell receptor T3 delta chain antibody (PE-Cy5), anti T-cell receptor T3 gamma chain antibody (PE-Cy5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T3 antibody (PE-Cy5), anti T3D antibody (PE-Cy5), anti T3E antibody (PE-Cy5), anti T3G antibody (PE-Cy5), anti T3Z antibody (PE-Cy5), anti TCRE antibody (PE-Cy5), anti TCRk antibody (PE-Cy5), anti TCRZ antibody (PE-Cy5), anti TCRzeta antibody (PE-Cy5)3870Synthetic peptide (Please contact us for more details)orb24886750 AssaysCD3 antibody (PE-Cy5)anti CD 3 antibody (PE-Cy5), anti Cd247 antibody (PE-Cy5), anti CD247 antigen antibody (PE-Cy5), anti CD247 antigen, zeta subunit antibody (PE-Cy5), anti CD247 molecule antibody (PE-Cy5), anti CD3 antibody (PE-Cy5), anti CD3 antigen, delta subunit antibody (PE-Cy5), anti CD3 delta antibody (PE-Cy5), anti CD3 epsilon antibody (PE-Cy5), anti CD3 eta antibody (PE-Cy5), anti CD3 gamma antibody (PE-Cy5), anti CD3 molecule delta polypeptide antibody (PE-Cy5), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy5), anti CD3 molecule, gamma polypeptide antibody (PE-Cy5), anti CD3 zeta antibody (PE-Cy5), anti CD3-DELTA antibody (PE-Cy5), anti CD3D antibody (PE-Cy5), anti CD3D antigen delta polypeptide antibody (PE-Cy5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3d molecule delta antibody (PE-Cy5), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy5), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy5), anti CD3E antibody (PE-Cy5), anti CD3e antigen antibody (PE-Cy5), anti CD3E antigen epsilon polypeptide antibody (PE-Cy5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3e molecule epsilon antibody (PE-Cy5), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy5), anti CD3epsilon antibody (PE-Cy5), anti CD3G antibody (PE-Cy5), anti CD3g antigen antibody (PE-Cy5), anti CD3G antigen gamma polypeptide antibody (PE-Cy5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3g molecule gamma antibody (PE-Cy5), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy5), anti CD3H antibody (PE-Cy5), anti CD3Q antibody (PE-Cy5), anti CD3Z antibody (PE-Cy5), anti CD3zeta antibody (PE-Cy5), anti Ctg3 antibody (PE-Cy5), anti IMD19 antibody (PE-Cy5), anti Leu-4 antibody (PE-Cy5), anti OKT3, delta chain antibody (PE-Cy5), anti T cell receptor antibody (PE-Cy5), anti T cell receptor T3 delta chain antibody (PE-Cy5), anti T cell receptor T3 gamma chain antibody (PE-Cy5), anti T cell receptor T3 zeta chain antibody (PE-Cy5), anti T cell receptor zeta chain antibody (PE-Cy5), anti T cell surface antigen antibody (PE-Cy5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 antibody (PE-Cy5), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy5), anti T-cell receptor T3 delta chain antibody (PE-Cy5), anti T-cell receptor T3 gamma chain antibody (PE-Cy5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T3 antibody (PE-Cy5), anti T3D antibody (PE-Cy5), anti T3E antibody (PE-Cy5), anti T3G antibody (PE-Cy5), anti T3Z antibody (PE-Cy5), anti TCRE antibody (PE-Cy5), anti TCRk antibody (PE-Cy5), anti TCRZ antibody (PE-Cy5), anti TCRzeta antibody (PE-Cy5)4050orb248867100 AssaysCD3 antibody (PE-Cy5)anti CD 3 antibody (PE-Cy5), anti Cd247 antibody (PE-Cy5), anti CD247 antigen antibody (PE-Cy5), anti CD247 antigen, zeta subunit antibody (PE-Cy5), anti CD247 molecule antibody (PE-Cy5), anti CD3 antibody (PE-Cy5), anti CD3 antigen, delta subunit antibody (PE-Cy5), anti CD3 delta antibody (PE-Cy5), anti CD3 epsilon antibody (PE-Cy5), anti CD3 eta antibody (PE-Cy5), anti CD3 gamma antibody (PE-Cy5), anti CD3 molecule delta polypeptide antibody (PE-Cy5), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy5), anti CD3 molecule, gamma polypeptide antibody (PE-Cy5), anti CD3 zeta antibody (PE-Cy5), anti CD3-DELTA antibody (PE-Cy5), anti CD3D antibody (PE-Cy5), anti CD3D antigen delta polypeptide antibody (PE-Cy5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3d molecule delta antibody (PE-Cy5), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy5), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy5), anti CD3E antibody (PE-Cy5), anti CD3e antigen antibody (PE-Cy5), anti CD3E antigen epsilon polypeptide antibody (PE-Cy5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3e molecule epsilon antibody (PE-Cy5), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy5), anti CD3epsilon antibody (PE-Cy5), anti CD3G antibody (PE-Cy5), anti CD3g antigen antibody (PE-Cy5), anti CD3G antigen gamma polypeptide antibody (PE-Cy5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3g molecule gamma antibody (PE-Cy5), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy5), anti CD3H antibody (PE-Cy5), anti CD3Q antibody (PE-Cy5), anti CD3Z antibody (PE-Cy5), anti CD3zeta antibody (PE-Cy5), anti Ctg3 antibody (PE-Cy5), anti IMD19 antibody (PE-Cy5), anti Leu-4 antibody (PE-Cy5), anti OKT3, delta chain antibody (PE-Cy5), anti T cell receptor antibody (PE-Cy5), anti T cell receptor T3 delta chain antibody (PE-Cy5), anti T cell receptor T3 gamma chain antibody (PE-Cy5), anti T cell receptor T3 zeta chain antibody (PE-Cy5), anti T cell receptor zeta chain antibody (PE-Cy5), anti T cell surface antigen antibody (PE-Cy5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 antibody (PE-Cy5), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy5), anti T-cell receptor T3 delta chain antibody (PE-Cy5), anti T-cell receptor T3 gamma chain antibody (PE-Cy5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T3 antibody (PE-Cy5), anti T3D antibody (PE-Cy5), anti T3E antibody (PE-Cy5), anti T3G antibody (PE-Cy5), anti T3Z antibody (PE-Cy5), anti TCRE antibody (PE-Cy5), anti TCRk antibody (PE-Cy5), anti TCRZ antibody (PE-Cy5), anti TCRzeta antibody (PE-Cy5)5940orb1192450 TestsCD3 antibody (PE-Cy5)anti CD 3 antibody (PE-Cy5), anti Cd247 antibody (PE-Cy5), anti CD247 antigen antibody (PE-Cy5), anti CD247 antigen, zeta subunit antibody (PE-Cy5), anti CD247 molecule antibody (PE-Cy5), anti CD3 antibody (PE-Cy5), anti CD3 antigen, delta subunit antibody (PE-Cy5), anti CD3 delta antibody (PE-Cy5), anti CD3 epsilon antibody (PE-Cy5), anti CD3 eta antibody (PE-Cy5), anti CD3 gamma antibody (PE-Cy5), anti CD3 molecule delta polypeptide antibody (PE-Cy5), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy5), anti CD3 molecule, gamma polypeptide antibody (PE-Cy5), anti CD3 zeta antibody (PE-Cy5), anti CD3-DELTA antibody (PE-Cy5), anti CD3D antibody (PE-Cy5), anti CD3D antigen delta polypeptide antibody (PE-Cy5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3d molecule delta antibody (PE-Cy5), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy5), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy5), anti CD3E antibody (PE-Cy5), anti CD3e antigen antibody (PE-Cy5), anti CD3E antigen epsilon polypeptide antibody (PE-Cy5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3e molecule epsilon antibody (PE-Cy5), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy5), anti CD3epsilon antibody (PE-Cy5), anti CD3G antibody (PE-Cy5), anti CD3g antigen antibody (PE-Cy5), anti CD3G antigen gamma polypeptide antibody (PE-Cy5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3g molecule gamma antibody (PE-Cy5), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy5), anti CD3H antibody (PE-Cy5), anti CD3Q antibody (PE-Cy5), anti CD3Z antibody (PE-Cy5), anti CD3zeta antibody (PE-Cy5), anti Ctg3 antibody (PE-Cy5), anti IMD19 antibody (PE-Cy5), anti Leu-4 antibody (PE-Cy5), anti OKT3, delta chain antibody (PE-Cy5), anti T cell receptor antibody (PE-Cy5), anti T cell receptor T3 delta chain antibody (PE-Cy5), anti T cell receptor T3 gamma chain antibody (PE-Cy5), anti T cell receptor T3 zeta chain antibody (PE-Cy5), anti T cell receptor zeta chain antibody (PE-Cy5), anti T cell surface antigen antibody (PE-Cy5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 antibody (PE-Cy5), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy5), anti T-cell receptor T3 delta chain antibody (PE-Cy5), anti T-cell receptor T3 gamma chain antibody (PE-Cy5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T3 antibody (PE-Cy5), anti T3D antibody (PE-Cy5), anti T3E antibody (PE-Cy5), anti T3G antibody (PE-Cy5), anti T3Z antibody (PE-Cy5), anti TCRE antibody (PE-Cy5), anti TCRk antibody (PE-Cy5), anti TCRZ antibody (PE-Cy5), anti TCRzeta antibody (PE-Cy5)3330orb11924100 TestsCD3 antibody (PE-Cy5)anti CD 3 antibody (PE-Cy5), anti Cd247 antibody (PE-Cy5), anti CD247 antigen antibody (PE-Cy5), anti CD247 antigen, zeta subunit antibody (PE-Cy5), anti CD247 molecule antibody (PE-Cy5), anti CD3 antibody (PE-Cy5), anti CD3 antigen, delta subunit antibody (PE-Cy5), anti CD3 delta antibody (PE-Cy5), anti CD3 epsilon antibody (PE-Cy5), anti CD3 eta antibody (PE-Cy5), anti CD3 gamma antibody (PE-Cy5), anti CD3 molecule delta polypeptide antibody (PE-Cy5), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy5), anti CD3 molecule, gamma polypeptide antibody (PE-Cy5), anti CD3 zeta antibody (PE-Cy5), anti CD3-DELTA antibody (PE-Cy5), anti CD3D antibody (PE-Cy5), anti CD3D antigen delta polypeptide antibody (PE-Cy5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3d molecule delta antibody (PE-Cy5), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy5), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy5), anti CD3E antibody (PE-Cy5), anti CD3e antigen antibody (PE-Cy5), anti CD3E antigen epsilon polypeptide antibody (PE-Cy5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3e molecule epsilon antibody (PE-Cy5), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy5), anti CD3epsilon antibody (PE-Cy5), anti CD3G antibody (PE-Cy5), anti CD3g antigen antibody (PE-Cy5), anti CD3G antigen gamma polypeptide antibody (PE-Cy5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy5), anti CD3g molecule gamma antibody (PE-Cy5), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy5), anti CD3H antibody (PE-Cy5), anti CD3Q antibody (PE-Cy5), anti CD3Z antibody (PE-Cy5), anti CD3zeta antibody (PE-Cy5), anti Ctg3 antibody (PE-Cy5), anti IMD19 antibody (PE-Cy5), anti Leu-4 antibody (PE-Cy5), anti OKT3, delta chain antibody (PE-Cy5), anti T cell receptor antibody (PE-Cy5), anti T cell receptor T3 delta chain antibody (PE-Cy5), anti T cell receptor T3 gamma chain antibody (PE-Cy5), anti T cell receptor T3 zeta chain antibody (PE-Cy5), anti T cell receptor zeta chain antibody (PE-Cy5), anti T cell surface antigen antibody (PE-Cy5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 antibody (PE-Cy5), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy5), anti T-cell receptor T3 delta chain antibody (PE-Cy5), anti T-cell receptor T3 gamma chain antibody (PE-Cy5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy5), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5), anti T3 antibody (PE-Cy5), anti T3D antibody (PE-Cy5), anti T3E antibody (PE-Cy5), anti T3G antibody (PE-Cy5), anti T3Z antibody (PE-Cy5), anti TCRE antibody (PE-Cy5), anti TCRk antibody (PE-Cy5), anti TCRZ antibody (PE-Cy5), anti TCRzeta antibody (PE-Cy5)4410orb130296100 ulCD3 antibody (PE-Cy5.5)anti CD 3 antibody (PE-Cy5.5), anti Cd247 antibody (PE-Cy5.5), anti CD247 antigen antibody (PE-Cy5.5), anti CD247 antigen, zeta subunit antibody (PE-Cy5.5), anti CD247 molecule antibody (PE-Cy5.5), anti CD3 antibody (PE-Cy5.5), anti CD3 antigen, delta subunit antibody (PE-Cy5.5), anti CD3 delta antibody (PE-Cy5.5), anti CD3 epsilon antibody (PE-Cy5.5), anti CD3 eta antibody (PE-Cy5.5), anti CD3 gamma antibody (PE-Cy5.5), anti CD3 molecule delta polypeptide antibody (PE-Cy5.5), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy5.5), anti CD3 molecule, gamma polypeptide antibody (PE-Cy5.5), anti CD3 zeta antibody (PE-Cy5.5), anti CD3-DELTA antibody (PE-Cy5.5), anti CD3D antibody (PE-Cy5.5), anti CD3D antigen delta polypeptide antibody (PE-Cy5.5), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy5.5), anti CD3d molecule delta antibody (PE-Cy5.5), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy5.5), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy5.5), anti CD3E antibody (PE-Cy5.5), anti CD3e antigen antibody (PE-Cy5.5), anti CD3E antigen epsilon polypeptide antibody (PE-Cy5.5), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy5.5), anti CD3e molecule epsilon antibody (PE-Cy5.5), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy5.5), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy5.5), anti CD3epsilon antibody (PE-Cy5.5), anti CD3G antibody (PE-Cy5.5), anti CD3g antigen antibody (PE-Cy5.5), anti CD3G antigen gamma polypeptide antibody (PE-Cy5.5), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy5.5), anti CD3g molecule gamma antibody (PE-Cy5.5), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy5.5), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy5.5), anti CD3H antibody (PE-Cy5.5), anti CD3Q antibody (PE-Cy5.5), anti CD3Z antibody (PE-Cy5.5), anti CD3zeta antibody (PE-Cy5.5), anti Ctg3 antibody (PE-Cy5.5), anti IMD19 antibody (PE-Cy5.5), anti Leu-4 antibody (PE-Cy5.5), anti OKT3, delta chain antibody (PE-Cy5.5), anti T cell receptor antibody (PE-Cy5.5), anti T cell receptor T3 delta chain antibody (PE-Cy5.5), anti T cell receptor T3 gamma chain antibody (PE-Cy5.5), anti T cell receptor T3 zeta chain antibody (PE-Cy5.5), anti T cell receptor zeta chain antibody (PE-Cy5.5), anti T cell surface antigen antibody (PE-Cy5.5), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy5.5), anti T cell surface glycoprotein CD3 antibody (PE-Cy5.5), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy5.5), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy5.5), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5.5), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy5.5), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy5.5), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy5.5), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy5.5), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy5.5), anti T-cell receptor T3 delta chain antibody (PE-Cy5.5), anti T-cell receptor T3 gamma chain antibody (PE-Cy5.5), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy5.5), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy5.5), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy5.5), anti T3 antibody (PE-Cy5.5), anti T3D antibody (PE-Cy5.5), anti T3E antibody (PE-Cy5.5), anti T3G antibody (PE-Cy5.5), anti T3Z antibody (PE-Cy5.5), anti TCRE antibody (PE-Cy5.5), anti TCRk antibody (PE-Cy5.5), anti TCRZ antibody (PE-Cy5.5), anti TCRzeta antibody (PE-Cy5.5)3870Synthetic peptide (Please contact us for more details)orb130788100 ulCD3 antibody (PE-Cy7)anti CD 3 antibody (PE-Cy7), anti Cd247 antibody (PE-Cy7), anti CD247 antigen antibody (PE-Cy7), anti CD247 antigen, zeta subunit antibody (PE-Cy7), anti CD247 molecule antibody (PE-Cy7), anti CD3 antibody (PE-Cy7), anti CD3 antigen, delta subunit antibody (PE-Cy7), anti CD3 delta antibody (PE-Cy7), anti CD3 epsilon antibody (PE-Cy7), anti CD3 eta antibody (PE-Cy7), anti CD3 gamma antibody (PE-Cy7), anti CD3 molecule delta polypeptide antibody (PE-Cy7), anti CD3 molecule, epsilon polypeptide antibody (PE-Cy7), anti CD3 molecule, gamma polypeptide antibody (PE-Cy7), anti CD3 zeta antibody (PE-Cy7), anti CD3-DELTA antibody (PE-Cy7), anti CD3D antibody (PE-Cy7), anti CD3D antigen delta polypeptide antibody (PE-Cy7), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PE-Cy7), anti CD3d molecule delta antibody (PE-Cy7), anti CD3d molecule delta CD3 TCR complex antibody (PE-Cy7), anti CD3d molecule, delta (CD3-TCR complex) antibody (PE-Cy7), anti CD3E antibody (PE-Cy7), anti CD3e antigen antibody (PE-Cy7), anti CD3E antigen epsilon polypeptide antibody (PE-Cy7), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PE-Cy7), anti CD3e molecule epsilon antibody (PE-Cy7), anti CD3e molecule epsilon CD3 TCR complex antibody (PE-Cy7), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PE-Cy7), anti CD3epsilon antibody (PE-Cy7), anti CD3G antibody (PE-Cy7), anti CD3g antigen antibody (PE-Cy7), anti CD3G antigen gamma polypeptide antibody (PE-Cy7), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PE-Cy7), anti CD3g molecule gamma antibody (PE-Cy7), anti CD3g molecule gamma CD3 TCR complex antibody (PE-Cy7), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PE-Cy7), anti CD3H antibody (PE-Cy7), anti CD3Q antibody (PE-Cy7), anti CD3Z antibody (PE-Cy7), anti CD3zeta antibody (PE-Cy7), anti Ctg3 antibody (PE-Cy7), anti IMD19 antibody (PE-Cy7), anti Leu-4 antibody (PE-Cy7), anti OKT3, delta chain antibody (PE-Cy7), anti T cell receptor antibody (PE-Cy7), anti T cell receptor T3 delta chain antibody (PE-Cy7), anti T cell receptor T3 gamma chain antibody (PE-Cy7), anti T cell receptor T3 zeta chain antibody (PE-Cy7), anti T cell receptor zeta chain antibody (PE-Cy7), anti T cell surface antigen antibody (PE-Cy7), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PE-Cy7), anti T cell surface glycoprotein CD3 antibody (PE-Cy7), anti T cell surface glycoprotein CD3 delta chain antibody (PE-Cy7), anti T cell surface glycoprotein CD3 epsilon chain antibody (PE-Cy7), anti T cell surface glycoprotein CD3 gamma chain antibody (PE-Cy7), anti T cell surface glycoprotein CD3 zeta chain antibody (PE-Cy7), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PE-Cy7), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PE-Cy7), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PE-Cy7), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PE-Cy7), anti T-cell receptor T3 delta chain antibody (PE-Cy7), anti T-cell receptor T3 gamma chain antibody (PE-Cy7), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PE-Cy7), anti T-cell surface glycoprotein CD3 delta chain antibody (PE-Cy7), anti T-cell surface glycoprotein CD3 gamma chain antibody (PE-Cy7), anti T3 antibody (PE-Cy7), anti T3D antibody (PE-Cy7), anti T3E antibody (PE-Cy7), anti T3G antibody (PE-Cy7), anti T3Z antibody (PE-Cy7), anti TCRE antibody (PE-Cy7), anti TCRk antibody (PE-Cy7), anti TCRZ antibody (PE-Cy7), anti TCRzeta antibody (PE-Cy7)3870Synthetic peptide (Please contact us for more details)orb1798740.1 mgCD3 antibody (PerCP)anti CD 3 antibody (PerCP), anti Cd247 antibody (PerCP), anti CD247 antigen antibody (PerCP), anti CD247 antigen, zeta subunit antibody (PerCP), anti CD247 molecule antibody (PerCP), anti CD3 antibody (PerCP), anti CD3 antigen, delta subunit antibody (PerCP), anti CD3 delta antibody (PerCP), anti CD3 epsilon antibody (PerCP), anti CD3 eta antibody (PerCP), anti CD3 gamma antibody (PerCP), anti CD3 molecule delta polypeptide antibody (PerCP), anti CD3 molecule, epsilon polypeptide antibody (PerCP), anti CD3 molecule, gamma polypeptide antibody (PerCP), anti CD3 zeta antibody (PerCP), anti CD3-DELTA antibody (PerCP), anti CD3D antibody (PerCP), anti CD3D antigen delta polypeptide antibody (PerCP), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PerCP), anti CD3d molecule delta antibody (PerCP), anti CD3d molecule delta CD3 TCR complex antibody (PerCP), anti CD3d molecule, delta (CD3-TCR complex) antibody (PerCP), anti CD3E antibody (PerCP), anti CD3e antigen antibody (PerCP), anti CD3E antigen epsilon polypeptide antibody (PerCP), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PerCP), anti CD3e molecule epsilon antibody (PerCP), anti CD3e molecule epsilon CD3 TCR complex antibody (PerCP), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PerCP), anti CD3epsilon antibody (PerCP), anti CD3G antibody (PerCP), anti CD3g antigen antibody (PerCP), anti CD3G antigen gamma polypeptide antibody (PerCP), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PerCP), anti CD3g molecule gamma antibody (PerCP), anti CD3g molecule gamma CD3 TCR complex antibody (PerCP), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PerCP), anti CD3H antibody (PerCP), anti CD3Q antibody (PerCP), anti CD3Z antibody (PerCP), anti CD3zeta antibody (PerCP), anti Ctg3 antibody (PerCP), anti IMD19 antibody (PerCP), anti Leu-4 antibody (PerCP), anti OKT3, delta chain antibody (PerCP), anti T cell receptor antibody (PerCP), anti T cell receptor T3 delta chain antibody (PerCP), anti T cell receptor T3 gamma chain antibody (PerCP), anti T cell receptor T3 zeta chain antibody (PerCP), anti T cell receptor zeta chain antibody (PerCP), anti T cell surface antigen antibody (PerCP), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PerCP), anti T cell surface glycoprotein CD3 antibody (PerCP), anti T cell surface glycoprotein CD3 delta chain antibody (PerCP), anti T cell surface glycoprotein CD3 epsilon chain antibody (PerCP), anti T cell surface glycoprotein CD3 gamma chain antibody (PerCP), anti T cell surface glycoprotein CD3 zeta chain antibody (PerCP), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PerCP), anti T-cell receptor T3 delta chain antibody (PerCP), anti T-cell receptor T3 gamma chain antibody (PerCP), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PerCP), anti T-cell surface glycoprotein CD3 delta chain antibody (PerCP), anti T-cell surface glycoprotein CD3 gamma chain antibody (PerCP), anti T3 antibody (PerCP), anti T3D antibody (PerCP), anti T3E antibody (PerCP), anti T3G antibody (PerCP), anti T3Z antibody (PerCP), anti TCRE antibody (PerCP), anti TCRk antibody (PerCP), anti TCRZ antibody (PerCP), anti TCRzeta antibody (PerCP)4410"Mouse BM10-37 cytotoxic T lymphocytes "orb44344100 testsCD3 antibody (PerCP)anti CD 3 antibody (PerCP), anti Cd247 antibody (PerCP), anti CD247 antigen antibody (PerCP), anti CD247 antigen, zeta subunit antibody (PerCP), anti CD247 molecule antibody (PerCP), anti CD3 antibody (PerCP), anti CD3 antigen, delta subunit antibody (PerCP), anti CD3 delta antibody (PerCP), anti CD3 epsilon antibody (PerCP), anti CD3 eta antibody (PerCP), anti CD3 gamma antibody (PerCP), anti CD3 molecule delta polypeptide antibody (PerCP), anti CD3 molecule, epsilon polypeptide antibody (PerCP), anti CD3 molecule, gamma polypeptide antibody (PerCP), anti CD3 zeta antibody (PerCP), anti CD3-DELTA antibody (PerCP), anti CD3D antibody (PerCP), anti CD3D antigen delta polypeptide antibody (PerCP), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PerCP), anti CD3d molecule delta antibody (PerCP), anti CD3d molecule delta CD3 TCR complex antibody (PerCP), anti CD3d molecule, delta (CD3-TCR complex) antibody (PerCP), anti CD3E antibody (PerCP), anti CD3e antigen antibody (PerCP), anti CD3E antigen epsilon polypeptide antibody (PerCP), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PerCP), anti CD3e molecule epsilon antibody (PerCP), anti CD3e molecule epsilon CD3 TCR complex antibody (PerCP), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PerCP), anti CD3epsilon antibody (PerCP), anti CD3G antibody (PerCP), anti CD3g antigen antibody (PerCP), anti CD3G antigen gamma polypeptide antibody (PerCP), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PerCP), anti CD3g molecule gamma antibody (PerCP), anti CD3g molecule gamma CD3 TCR complex antibody (PerCP), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PerCP), anti CD3H antibody (PerCP), anti CD3Q antibody (PerCP), anti CD3Z antibody (PerCP), anti CD3zeta antibody (PerCP), anti Ctg3 antibody (PerCP), anti IMD19 antibody (PerCP), anti Leu-4 antibody (PerCP), anti OKT3, delta chain antibody (PerCP), anti T cell receptor antibody (PerCP), anti T cell receptor T3 delta chain antibody (PerCP), anti T cell receptor T3 gamma chain antibody (PerCP), anti T cell receptor T3 zeta chain antibody (PerCP), anti T cell receptor zeta chain antibody (PerCP), anti T cell surface antigen antibody (PerCP), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PerCP), anti T cell surface glycoprotein CD3 antibody (PerCP), anti T cell surface glycoprotein CD3 delta chain antibody (PerCP), anti T cell surface glycoprotein CD3 epsilon chain antibody (PerCP), anti T cell surface glycoprotein CD3 gamma chain antibody (PerCP), anti T cell surface glycoprotein CD3 zeta chain antibody (PerCP), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PerCP), anti T-cell receptor T3 delta chain antibody (PerCP), anti T-cell receptor T3 gamma chain antibody (PerCP), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PerCP), anti T-cell surface glycoprotein CD3 delta chain antibody (PerCP), anti T-cell surface glycoprotein CD3 gamma chain antibody (PerCP), anti T3 antibody (PerCP), anti T3D antibody (PerCP), anti T3E antibody (PerCP), anti T3G antibody (PerCP), anti T3Z antibody (PerCP), anti TCRE antibody (PerCP), anti TCRk antibody (PerCP), anti TCRZ antibody (PerCP), anti TCRzeta antibody (PerCP)5670orb44565100 testsCD3 antibody (PerCP)anti CD 3 antibody (PerCP), anti Cd247 antibody (PerCP), anti CD247 antigen antibody (PerCP), anti CD247 antigen, zeta subunit antibody (PerCP), anti CD247 molecule antibody (PerCP), anti CD3 antibody (PerCP), anti CD3 antigen, delta subunit antibody (PerCP), anti CD3 delta antibody (PerCP), anti CD3 epsilon antibody (PerCP), anti CD3 eta antibody (PerCP), anti CD3 gamma antibody (PerCP), anti CD3 molecule delta polypeptide antibody (PerCP), anti CD3 molecule, epsilon polypeptide antibody (PerCP), anti CD3 molecule, gamma polypeptide antibody (PerCP), anti CD3 zeta antibody (PerCP), anti CD3-DELTA antibody (PerCP), anti CD3D antibody (PerCP), anti CD3D antigen delta polypeptide antibody (PerCP), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (PerCP), anti CD3d molecule delta antibody (PerCP), anti CD3d molecule delta CD3 TCR complex antibody (PerCP), anti CD3d molecule, delta (CD3-TCR complex) antibody (PerCP), anti CD3E antibody (PerCP), anti CD3e antigen antibody (PerCP), anti CD3E antigen epsilon polypeptide antibody (PerCP), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (PerCP), anti CD3e molecule epsilon antibody (PerCP), anti CD3e molecule epsilon CD3 TCR complex antibody (PerCP), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (PerCP), anti CD3epsilon antibody (PerCP), anti CD3G antibody (PerCP), anti CD3g antigen antibody (PerCP), anti CD3G antigen gamma polypeptide antibody (PerCP), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (PerCP), anti CD3g molecule gamma antibody (PerCP), anti CD3g molecule gamma CD3 TCR complex antibody (PerCP), anti CD3g molecule, gamma (CD3-TCR complex) antibody (PerCP), anti CD3H antibody (PerCP), anti CD3Q antibody (PerCP), anti CD3Z antibody (PerCP), anti CD3zeta antibody (PerCP), anti Ctg3 antibody (PerCP), anti IMD19 antibody (PerCP), anti Leu-4 antibody (PerCP), anti OKT3, delta chain antibody (PerCP), anti T cell receptor antibody (PerCP), anti T cell receptor T3 delta chain antibody (PerCP), anti T cell receptor T3 gamma chain antibody (PerCP), anti T cell receptor T3 zeta chain antibody (PerCP), anti T cell receptor zeta chain antibody (PerCP), anti T cell surface antigen antibody (PerCP), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (PerCP), anti T cell surface glycoprotein CD3 antibody (PerCP), anti T cell surface glycoprotein CD3 delta chain antibody (PerCP), anti T cell surface glycoprotein CD3 epsilon chain antibody (PerCP), anti T cell surface glycoprotein CD3 gamma chain antibody (PerCP), anti T cell surface glycoprotein CD3 zeta chain antibody (PerCP), anti T-cell antigen receptor complex, delta subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (PerCP), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (PerCP), anti T-cell receptor T3 delta chain antibody (PerCP), anti T-cell receptor T3 gamma chain antibody (PerCP), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (PerCP), anti T-cell surface glycoprotein CD3 delta chain antibody (PerCP), anti T-cell surface glycoprotein CD3 gamma chain antibody (PerCP), anti T3 antibody (PerCP), anti T3D antibody (PerCP), anti T3E antibody (PerCP), anti T3G antibody (PerCP), anti T3Z antibody (PerCP), anti TCRE antibody (PerCP), anti TCRk antibody (PerCP), anti TCRZ antibody (PerCP), anti TCRzeta antibody (PerCP)5670orb389783100 testsCD3 antibody (PerCP)5670Human thymocytesorb131280100 ulCD3 antibody (RBITC)anti CD 3 antibody (RBITC), anti Cd247 antibody (RBITC), anti CD247 antigen antibody (RBITC), anti CD247 antigen, zeta subunit antibody (RBITC), anti CD247 molecule antibody (RBITC), anti CD3 antibody (RBITC), anti CD3 antigen, delta subunit antibody (RBITC), anti CD3 delta antibody (RBITC), anti CD3 epsilon antibody (RBITC), anti CD3 eta antibody (RBITC), anti CD3 gamma antibody (RBITC), anti CD3 molecule delta polypeptide antibody (RBITC), anti CD3 molecule, epsilon polypeptide antibody (RBITC), anti CD3 molecule, gamma polypeptide antibody (RBITC), anti CD3 zeta antibody (RBITC), anti CD3-DELTA antibody (RBITC), anti CD3D antibody (RBITC), anti CD3D antigen delta polypeptide antibody (RBITC), anti CD3d antigen, delta polypeptide (TiT3 complex) antibody (RBITC), anti CD3d molecule delta antibody (RBITC), anti CD3d molecule delta CD3 TCR complex antibody (RBITC), anti CD3d molecule, delta (CD3-TCR complex) antibody (RBITC), anti CD3E antibody (RBITC), anti CD3e antigen antibody (RBITC), anti CD3E antigen epsilon polypeptide antibody (RBITC), anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody (RBITC), anti CD3e molecule epsilon antibody (RBITC), anti CD3e molecule epsilon CD3 TCR complex antibody (RBITC), anti CD3e molecule, epsilon (CD3-TCR complex) antibody (RBITC), anti CD3epsilon antibody (RBITC), anti CD3G antibody (RBITC), anti CD3g antigen antibody (RBITC), anti CD3G antigen gamma polypeptide antibody (RBITC), anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody (RBITC), anti CD3g molecule gamma antibody (RBITC), anti CD3g molecule gamma CD3 TCR complex antibody (RBITC), anti CD3g molecule, gamma (CD3-TCR complex) antibody (RBITC), anti CD3H antibody (RBITC), anti CD3Q antibody (RBITC), anti CD3Z antibody (RBITC), anti CD3zeta antibody (RBITC), anti Ctg3 antibody (RBITC), anti IMD19 antibody (RBITC), anti Leu-4 antibody (RBITC), anti OKT3, delta chain antibody (RBITC), anti T cell receptor antibody (RBITC), anti T cell receptor T3 delta chain antibody (RBITC), anti T cell receptor T3 gamma chain antibody (RBITC), anti T cell receptor T3 zeta chain antibody (RBITC), anti T cell receptor zeta chain antibody (RBITC), anti T cell surface antigen antibody (RBITC), anti T cell surface antigen T3/Leu 4 epsilon chain antibody (RBITC), anti T cell surface glycoprotein CD3 antibody (RBITC), anti T cell surface glycoprotein CD3 delta chain antibody (RBITC), anti T cell surface glycoprotein CD3 epsilon chain antibody (RBITC), anti T cell surface glycoprotein CD3 gamma chain antibody (RBITC), anti T cell surface glycoprotein CD3 zeta chain antibody (RBITC), anti T-cell antigen receptor complex, delta subunit of T3 antibody (RBITC), anti T-cell antigen receptor complex, epsilon subunit of T3 antibody (RBITC), anti T-cell antigen receptor complex, gamma subunit of T3 antibody (RBITC), anti T-cell antigen receptor complex, zeta subunit of CD3 antibody (RBITC), anti T-cell receptor T3 delta chain antibody (RBITC), anti T-cell receptor T3 gamma chain antibody (RBITC), anti T-cell surface antigen T3/Leu-4 epsilon chain antibody (RBITC), anti T-cell surface glycoprotein CD3 delta chain antibody (RBITC), anti T-cell surface glycoprotein CD3 gamma chain antibody (RBITC), anti T3 antibody (RBITC), anti T3D antibody (RBITC), anti T3E antibody (RBITC), anti T3G antibody (RBITC), anti T3Z antibody (RBITC), anti TCRE antibody (RBITC), anti TCRk antibody (RBITC), anti TCRZ antibody (RBITC), anti TCRzeta antibody (RBITC)3870Synthetic peptide (Please contact us for more details)orb160325100 ugCD3 delta antibodyAnti-CD3 antigen delta subunit antibody, Anti-CD3 delta antibody, Anti-CD3d antibody, Anti-CD3d antigen delta polypeptide (TiT3 complex) antibody, Anti-CD3d molecule delta (CD3-TCR complex) antibody, Anti-CD3D_HUMAN antibody, Anti-IMD19 antibody, Anti-OKT3 delta chain antibody, Anti-T cell receptor T3 delta chain antibody, Anti-T-cell receptor T3 delta chain antibody, Anti-T-cell surface glycoprotein CD3 delta chain antibody, Anti-T3D antibody, Anti- CD3-delta antibody2970Synthesized peptide derived from the Internal region of human CD3- delta.orb160326100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970Synthesized peptide derived from the Internal region of human CD3- epsilon.orb314892100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870H-2Kb-specific murine cytotoxic T-lymphocyte (CTL) cloneorb314895100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Human infant thymocytesorb314896100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Human infant thymocytesorb348845100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Recombinant proteinorb348878100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Recombinant proteinorb348890100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Recombinant proteinorb348901100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Recombinant proteinorb1175100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3330Synthetic peptide (please contact us for details)orb1175200 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4500Synthetic peptide (please contact us for details)orb1762100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2970Synthetic peptide (please contact us for details)orb1762200 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Synthetic peptide (please contact us for details)orb42187100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6390Recombinant human CD3E protein.orb4218750 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4410Recombinant human CD3E protein.orb316440100 ulCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6390orb378644100 ulCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4230Synthetic peptideorb88826250 ulCD3 Epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6660orb17101550 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4050Recombinant Human CD3E protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD3Eorb171015100 ugCD3 epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6030Recombinant Human CD3E protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD3Eorb8699850 ugCD3 Epsilon antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody7470orb311373100 ulCD3- Epsilon antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4716KLH Conjugated synthetic peptideorb3205100 ugCD3 epsilon antibody (FITC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Synthetic peptide (please contact us for details)orb3792100 ugCD3 epsilon antibody (FITC)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3870Synthetic peptide (please contact us for details)orb198279100 TestsCD3 epsilon antibody (FITC, PE)Anti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb394859100 ugCD3 gamma antibody6552CD3g molecule, gamma (CD3-TCR complex)orb2227670.1 mgCD3 zeta (Phospho-Tyr111) antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690BP1 (pTyr111/123) - KLHorb2227660.1 mgCD3 zeta (Phospho-Tyr142) antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3690CP1 (pTyr142) - KLHorb127821100 ugCD3 zeta (phospho-Tyr142) antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody2880Synthesized phosphopeptide derived from human CD3 zeta around the phosphorylation site of tyrosine 142 (G-L-YP-Q-G).orb127821200 ugCD3 zeta (phospho-Tyr142) antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4140Synthesized phosphopeptide derived from human CD3 zeta around the phosphorylation site of tyrosine 142 (G-L-YP-Q-G).orb191521100 ulCD3 zeta (Phospho-Tyr142) antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody4716Peptide sequence around phosphorylation site of tyrosine 142 (G-L-Y(p)-Q-G) derived from Human CD3 zeta.orb228064100 ulCD3 Zeta (Phospho-Tyr142) antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3798A synthesized peptide derived from human CD3 Zeta (Phospho-Tyr142)orb22806420 ulCD3 Zeta (Phospho-Tyr142) antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2736A synthesized peptide derived from human CD3 Zeta (Phospho-Tyr142)orb22806450 ulCD3 Zeta (Phospho-Tyr142) antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3258A synthesized peptide derived from human CD3 Zeta (Phospho-Tyr142)orb1798750.1 mgCD3 zeta antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690A phospho specific peptide corresponding to the amino acids surrounding tyrosine 153 of mouse CD3 zeta linked to KLHorb1798760.1 mgCD3 zeta antibodyanti CD 3 antibody, anti Cd247 antibody, anti CD247 antigen antibody, anti CD247 antigen, zeta subunit antibody, anti CD247 molecule antibody, anti CD3 antibody, anti CD3 antigen, delta subunit antibody, anti CD3 delta antibody, anti CD3 epsilon antibody, anti CD3 eta antibody, anti CD3 gamma antibody, anti CD3 molecule delta polypeptide antibody, anti CD3 molecule, epsilon polypeptide antibody, anti CD3 molecule, gamma polypeptide antibody, anti CD3 zeta antibody, anti CD3-DELTA antibody, anti CD3D antibody, anti CD3D antigen delta polypeptide antibody, anti CD3d antigen, delta polypeptide (TiT3 complex) antibody, anti CD3d molecule delta antibody, anti CD3d molecule delta CD3 TCR complex antibody, anti CD3d molecule, delta (CD3-TCR complex) antibody, anti CD3E antibody, anti CD3e antigen antibody, anti CD3E antigen epsilon polypeptide antibody, anti CD3e antigen, epsilon polypeptide (TiT3 complex) antibody, anti CD3e molecule epsilon antibody, anti CD3e molecule epsilon CD3 TCR complex antibody, anti CD3e molecule, epsilon (CD3-TCR complex) antibody, anti CD3epsilon antibody, anti CD3G antibody, anti CD3g antigen antibody, anti CD3G antigen gamma polypeptide antibody, anti CD3g antigen, gamma polypeptide (TiT3 complex) antibody, anti CD3g molecule gamma antibody, anti CD3g molecule gamma CD3 TCR complex antibody, anti CD3g molecule, gamma (CD3-TCR complex) antibody, anti CD3H antibody, anti CD3Q antibody, anti CD3Z antibody, anti CD3zeta antibody, anti Ctg3 antibody, anti IMD19 antibody, anti Leu-4 antibody, anti OKT3, delta chain antibody, anti T cell receptor antibody, anti T cell receptor T3 delta chain antibody, anti T cell receptor T3 gamma chain antibody, anti T cell receptor T3 zeta chain antibody, anti T cell receptor zeta chain antibody, anti T cell surface antigen antibody, anti T cell surface antigen T3/Leu 4 epsilon chain antibody, anti T cell surface glycoprotein CD3 antibody, anti T cell surface glycoprotein CD3 delta chain antibody, anti T cell surface glycoprotein CD3 epsilon chain antibody, anti T cell surface glycoprotein CD3 gamma chain antibody, anti T cell surface glycoprotein CD3 zeta chain antibody, anti T-cell antigen receptor complex, delta subunit of T3 antibody, anti T-cell antigen receptor complex, epsilon subunit of T3 antibody, anti T-cell antigen receptor complex, gamma subunit of T3 antibody, anti T-cell antigen receptor complex, zeta subunit of CD3 antibody, anti T-cell receptor T3 delta chain antibody, anti T-cell receptor T3 gamma chain antibody, anti T-cell surface antigen T3/Leu-4 epsilon chain antibody, anti T-cell surface glycoprotein CD3 delta chain antibody, anti T-cell surface glycoprotein CD3 gamma chain antibody, anti T3 antibody, anti T3D antibody, anti T3E antibody, anti T3G antibody, anti T3Z antibody, anti TCRE antibody, anti TCRk antibody, anti TCRZ antibody, anti TCRzeta antibody3690A phospho specific peptide corresponding to the amino acids surrounding tyrosine 72 of mouse CD3 zeta linked to KLHorb389763100 ugCD3 zeta antibody4410"Synthetic peptide corresponding to amino acids 151-164 of mouse CD3 zeta. "orb13116100 ulCD3 zeta antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody4230This antibody is produced by immunizing rabbits with a synthetic peptide (KLH-coupled) corresponding to a region of C-terminal residues of CD3 zeta.orb228044100 ulCD3 Zeta antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3798A synthesized peptide derived from human CD3 Zetaorb22804420 ulCD3 Zeta antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody2736A synthesized peptide derived from human CD3 Zetaorb22804450 ulCD3 Zeta antibodyAnti-FLJ18683 antibody, Anti-T3E antibody, Anti-TCRE antibody, Anti-CD3E antibody, Anti-CD3-epsilon antibody, Anti-CD3 epsilon antibody, Anti-CD3E antibody, Anti-CD3E antigen epsilon polypeptide (TiT3 complex) antibody, Anti-CD3E antigen epsilon polypeptide antibody, Anti-CD3E antigen, epsilon subunit antibody, Anti-CD3E molecule epsilon antibody, Anti-CD3E molecule, epsilon (CD3 TCR complex) antibody, Anti-CD3E molecule, epsilon (CD3-TCR complex) antibody, Anti-CD3E_HUMAN antibody, Anti-IMD18 antibody, Anti-T cell antigen receptor complex epsilon subunit of T3 antibody, Anti-T cell surface antigen T3/Leu 4 epsilon chain antibody, Anti-T cell surface glycoprotein CD3 epsilon chain antibody, Anti-T-cell surface antigen T3/Leu-4 epsilon chain antibody, Anti-T-cell surface glycoprotein CD3 epsilon chain antibody, Anti-T3E antibody, Anti-TCRE antibody3258A synthesized peptide derived from human CD3 Zetaorb389764100 ugCD3 zeta antibody (FITC)4410"Synthetic peptide corresponding to amino acids 151-164 of mouse CD3 zeta. "orb198273100 TestsCD3, CD25 antibody (FITC, PE)anti CD25 antibody (FITC, PE), anti CD 25 antibody (FITC, PE), anti IL 2 receptor subunit alpha antibody (FITC, PE), anti IL 2R subunit alpha antibody (FITC, PE), anti IL-2 receptor subunit alpha antibody (FITC, PE), anti IL2 RA antibody (FITC, PE), anti IL2 Receptor alpha antibody (FITC, PE), anti IL2-RA antibody (FITC, PE), anti IL2R alpha chain antibody (FITC, PE), anti IL2R antibody (FITC, PE), anti IL2R subunit alpha antibody (FITC, PE), anti IL2RA antibody (FITC, PE), anti Interleukin 2 receptor alpha chain antibody (FITC, PE), anti interleukin 2 receptor subunit alpha antibody (FITC, PE), anti T Cell Growth Factor Receptor antibody (FITC, PE), anti TAC antigen antibody (FITC, PE), anti TCGFR antibody (FITC, PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activatorb19815350 TestsCD3, CD25 antibody (FITC, PE)anti CD25 antibody (FITC, PE), anti CD 25 antibody (FITC, PE), anti IL 2 receptor subunit alpha antibody (FITC, PE), anti IL 2R subunit alpha antibody (FITC, PE), anti IL-2 receptor subunit alpha antibody (FITC, PE), anti IL2 RA antibody (FITC, PE), anti IL2 Receptor alpha antibody (FITC, PE), anti IL2-RA antibody (FITC, PE), anti IL2R alpha chain antibody (FITC, PE), anti IL2R antibody (FITC, PE), anti IL2R subunit alpha antibody (FITC, PE), anti IL2RA antibody (FITC, PE), anti Interleukin 2 receptor alpha chain antibody (FITC, PE), anti interleukin 2 receptor subunit alpha antibody (FITC, PE), anti T Cell Growth Factor Receptor antibody (FITC, PE), anti TAC antigen antibody (FITC, PE), anti TCGFR antibody (FITC, PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD25: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells of BALB/c mice immunized with PHA-activaorb198274100 TestsCD3, CD26 antibody (FITC, PE)anti CD26 antigen antibody (FITC, PE), anti ADA-binding protein antibody (FITC, PE), anti ADABP antibody (FITC, PE), anti ADCP 2 antibody (FITC, PE), anti ADCP-2 antibody (FITC, PE), anti ADCP2 antibody (FITC, PE), anti CD 26 antibody (FITC, PE), anti CD26 antibody (FITC, PE), anti CD26 antigen 3 antibody (FITC, PE), anti Dipeptidyl peptidase 4 antibody (FITC, PE), anti Dipeptidyl peptidase 4 soluble form antibody (FITC, PE), anti Dipeptidyl peptidase iv antibody (FITC, PE), anti Dipeptidyl peptidase IV soluble form antibody (FITC, PE), anti Dipeptidyl peptidase, intestinal antibody (FITC, PE), anti Dipeptidylpeptidase 4 antibody (FITC, PE), anti Dipeptidylpeptidase IV antibody (FITC, PE), anti DPP 4 antibody (FITC, PE), anti DPP IV antibody (FITC, PE), anti DPP IV estoenzyme antibody (FITC, PE), anti DPP4 antibody (FITC, PE), anti DPPIV antibody (FITC, PE), anti Intestinal dipeptidyl peptidase antibody (FITC, PE), anti T cell activation antigen CD26 antibody (FITC, PE), anti TP 103 antibody (FITC, PE), anti TP103 antibody (FITC, PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb19815450 TestsCD3, CD26 antibody (FITC, PE)anti CD26 antigen antibody (FITC, PE), anti ADA-binding protein antibody (FITC, PE), anti ADABP antibody (FITC, PE), anti ADCP 2 antibody (FITC, PE), anti ADCP-2 antibody (FITC, PE), anti ADCP2 antibody (FITC, PE), anti CD 26 antibody (FITC, PE), anti CD26 antibody (FITC, PE), anti CD26 antigen 3 antibody (FITC, PE), anti Dipeptidyl peptidase 4 antibody (FITC, PE), anti Dipeptidyl peptidase 4 soluble form antibody (FITC, PE), anti Dipeptidyl peptidase iv antibody (FITC, PE), anti Dipeptidyl peptidase IV soluble form antibody (FITC, PE), anti Dipeptidyl peptidase, intestinal antibody (FITC, PE), anti Dipeptidylpeptidase 4 antibody (FITC, PE), anti Dipeptidylpeptidase IV antibody (FITC, PE), anti DPP 4 antibody (FITC, PE), anti DPP IV antibody (FITC, PE), anti DPP IV estoenzyme antibody (FITC, PE), anti DPP4 antibody (FITC, PE), anti DPPIV antibody (FITC, PE), anti Intestinal dipeptidyl peptidase antibody (FITC, PE), anti T cell activation antigen CD26 antibody (FITC, PE), anti TP 103 antibody (FITC, PE), anti TP103 antibody (FITC, PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes.orb198310100 TestsCD3, CD4 antibody (FITC, PE)anti CD 4 antibody (FITC/PE), anti CD4 (L3T4) antibody (FITC/PE), anti CD4 antibody (FITC/PE), anti CD4 antigen (p55) antibody (FITC/PE), anti CD4 Antigen antibody (FITC/PE), anti CD4 molecule antibody (FITC/PE), anti CD4 Receptor antibody (FITC/PE), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE), anti CD4mut antibody (FITC/PE), anti L3T4 antibody (FITC/PE), anti Leu3 antibody (FITC/PE), anti Ly-4 antibody (FITC/PE), anti Lymphocyte antigen CD4 antibody (FITC/PE), anti T Cell Antigen T4 antibody (FITC/PE), anti T cell antigen T4/LEU3 antibody (FITC/PE), anti T cell differentiation antigen L3T4 antibody (FITC/PE), anti T cell OKT4 deficiency, included antibody (FITC/PE), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE), anti T cell surface antigen T4/Leu3 antibody (FITC/PE), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE), anti T-cell surface glycoprotein CD4 antibody (FITC/PE), anti W3/25 antibody (FITC/PE), anti W3/25 antigen antibody (FITC/PE)6120CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD4: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells from BALB/c mice immunized with human perorb19820750 TestsCD3, CD4 antibody (FITC, PE)anti CD 4 antibody (FITC/PE), anti CD4 (L3T4) antibody (FITC/PE), anti CD4 antibody (FITC/PE), anti CD4 antigen (p55) antibody (FITC/PE), anti CD4 Antigen antibody (FITC/PE), anti CD4 molecule antibody (FITC/PE), anti CD4 Receptor antibody (FITC/PE), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE), anti CD4mut antibody (FITC/PE), anti L3T4 antibody (FITC/PE), anti Leu3 antibody (FITC/PE), anti Ly-4 antibody (FITC/PE), anti Lymphocyte antigen CD4 antibody (FITC/PE), anti T Cell Antigen T4 antibody (FITC/PE), anti T cell antigen T4/LEU3 antibody (FITC/PE), anti T cell differentiation antigen L3T4 antibody (FITC/PE), anti T cell OKT4 deficiency, included antibody (FITC/PE), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE), anti T cell surface antigen T4/Leu3 antibody (FITC/PE), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE), anti T-cell surface glycoprotein CD4 antibody (FITC/PE), anti W3/25 antibody (FITC/PE), anti W3/25 antigen antibody (FITC/PE)4590CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD4: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells from BALB/c mice immunized with human perorb198369100 TestsCD3, CD4, CD45 antibody (FITC, PE, Cy5)anti CD 4 antibody (FITC/PE/Cy5), anti CD4 (L3T4) antibody (FITC/PE/Cy5), anti CD4 antibody (FITC/PE/Cy5), anti CD4 antigen (p55) antibody (FITC/PE/Cy5), anti CD4 Antigen antibody (FITC/PE/Cy5), anti CD4 molecule antibody (FITC/PE/Cy5), anti CD4 Receptor antibody (FITC/PE/Cy5), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE/Cy5), anti CD4mut antibody (FITC/PE/Cy5), anti L3T4 antibody (FITC/PE/Cy5), anti Leu3 antibody (FITC/PE/Cy5), anti Ly-4 antibody (FITC/PE/Cy5), anti Lymphocyte antigen CD4 antibody (FITC/PE/Cy5), anti T Cell Antigen T4 antibody (FITC/PE/Cy5), anti T cell antigen T4/LEU3 antibody (FITC/PE/Cy5), anti T cell differentiation antigen L3T4 antibody (FITC/PE/Cy5), anti T cell OKT4 deficiency, included antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE/Cy5), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE/Cy5), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE/Cy5), anti T-cell surface glycoprotein CD4 antibody (FITC/PE/Cy5), anti W3/25 antibody (FITC/PE/Cy5), anti W3/25 antigen antibody (FITC/PE/Cy5)8280CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD4: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells from BALB/c mice immunized with human perorb19823950 TestsCD3, CD4, CD45 antibody (FITC, PE, Cy5)anti CD 4 antibody (FITC/PE/Cy5), anti CD4 (L3T4) antibody (FITC/PE/Cy5), anti CD4 antibody (FITC/PE/Cy5), anti CD4 antigen (p55) antibody (FITC/PE/Cy5), anti CD4 Antigen antibody (FITC/PE/Cy5), anti CD4 molecule antibody (FITC/PE/Cy5), anti CD4 Receptor antibody (FITC/PE/Cy5), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE/Cy5), anti CD4mut antibody (FITC/PE/Cy5), anti L3T4 antibody (FITC/PE/Cy5), anti Leu3 antibody (FITC/PE/Cy5), anti Ly-4 antibody (FITC/PE/Cy5), anti Lymphocyte antigen CD4 antibody (FITC/PE/Cy5), anti T Cell Antigen T4 antibody (FITC/PE/Cy5), anti T cell antigen T4/LEU3 antibody (FITC/PE/Cy5), anti T cell differentiation antigen L3T4 antibody (FITC/PE/Cy5), anti T cell OKT4 deficiency, included antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE/Cy5), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE/Cy5), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE/Cy5), anti T-cell surface glycoprotein CD4 antibody (FITC/PE/Cy5), anti W3/25 antibody (FITC/PE/Cy5), anti W3/25 antigen antibody (FITC/PE/Cy5)5580CD3: Derived from the hybridization of mouse NS-1 myeloma celss with spleen cells from BALB/c mice immunized with human thymocytes. CD4: Derived from the hybridization of mouse NS-1 myeloma cells with spleen cells from BALB/c mice immunized with human perorb1215320 TestsCD3/CD4 antibody (FITC/PE)anti CD 4 antibody (FITC/PE), anti CD4 (L3T4) antibody (FITC/PE), anti CD4 antibody (FITC/PE), anti CD4 antigen (p55) antibody (FITC/PE), anti CD4 Antigen antibody (FITC/PE), anti CD4 molecule antibody (FITC/PE), anti CD4 Receptor antibody (FITC/PE), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE), anti CD4mut antibody (FITC/PE), anti L3T4 antibody (FITC/PE), anti Leu3 antibody (FITC/PE), anti Ly-4 antibody (FITC/PE), anti Lymphocyte antigen CD4 antibody (FITC/PE), anti T Cell Antigen T4 antibody (FITC/PE), anti T cell antigen T4/LEU3 antibody (FITC/PE), anti T cell differentiation antigen L3T4 antibody (FITC/PE), anti T cell OKT4 deficiency, included antibody (FITC/PE), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE), anti T cell surface antigen T4/Leu3 antibody (FITC/PE), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE), anti T-cell surface glycoprotein CD4 antibody (FITC/PE), anti W3/25 antibody (FITC/PE), anti W3/25 antigen antibody (FITC/PE)2700orb1215350 TestsCD3/CD4 antibody (FITC/PE)anti CD 4 antibody (FITC/PE), anti CD4 (L3T4) antibody (FITC/PE), anti CD4 antibody (FITC/PE), anti CD4 antigen (p55) antibody (FITC/PE), anti CD4 Antigen antibody (FITC/PE), anti CD4 molecule antibody (FITC/PE), anti CD4 Receptor antibody (FITC/PE), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE), anti CD4mut antibody (FITC/PE), anti L3T4 antibody (FITC/PE), anti Leu3 antibody (FITC/PE), anti Ly-4 antibody (FITC/PE), anti Lymphocyte antigen CD4 antibody (FITC/PE), anti T Cell Antigen T4 antibody (FITC/PE), anti T cell antigen T4/LEU3 antibody (FITC/PE), anti T cell differentiation antigen L3T4 antibody (FITC/PE), anti T cell OKT4 deficiency, included antibody (FITC/PE), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE), anti T cell surface antigen T4/Leu3 antibody (FITC/PE), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE), anti T-cell surface glycoprotein CD4 antibody (FITC/PE), anti W3/25 antibody (FITC/PE), anti W3/25 antigen antibody (FITC/PE)4140orb1217320 TestsCD3/CD4/CD25 antibody (FITC/PE/Cy5)anti CD25 antibody (FITC/PE/Cy5), anti CD 25 antibody (FITC/PE/Cy5), anti IL 2 receptor subunit alpha antibody (FITC/PE/Cy5), anti IL 2R subunit alpha antibody (FITC/PE/Cy5), anti IL-2 receptor subunit alpha antibody (FITC/PE/Cy5), anti IL2 RA antibody (FITC/PE/Cy5), anti IL2 Receptor alpha antibody (FITC/PE/Cy5), anti IL2-RA antibody (FITC/PE/Cy5), anti IL2R alpha chain antibody (FITC/PE/Cy5), anti IL2R antibody (FITC/PE/Cy5), anti IL2R subunit alpha antibody (FITC/PE/Cy5), anti IL2RA antibody (FITC/PE/Cy5), anti Interleukin 2 receptor alpha chain antibody (FITC/PE/Cy5), anti interleukin 2 receptor subunit alpha antibody (FITC/PE/Cy5), anti T Cell Growth Factor Receptor antibody (FITC/PE/Cy5), anti TAC antigen antibody (FITC/PE/Cy5), anti TCGFR antibody (FITC/PE/Cy5)2970orb1217350 TestsCD3/CD4/CD25 antibody (FITC/PE/Cy5)anti CD25 antibody (FITC/PE/Cy5), anti CD 25 antibody (FITC/PE/Cy5), anti IL 2 receptor subunit alpha antibody (FITC/PE/Cy5), anti IL 2R subunit alpha antibody (FITC/PE/Cy5), anti IL-2 receptor subunit alpha antibody (FITC/PE/Cy5), anti IL2 RA antibody (FITC/PE/Cy5), anti IL2 Receptor alpha antibody (FITC/PE/Cy5), anti IL2-RA antibody (FITC/PE/Cy5), anti IL2R alpha chain antibody (FITC/PE/Cy5), anti IL2R antibody (FITC/PE/Cy5), anti IL2R subunit alpha antibody (FITC/PE/Cy5), anti IL2RA antibody (FITC/PE/Cy5), anti Interleukin 2 receptor alpha chain antibody (FITC/PE/Cy5), anti interleukin 2 receptor subunit alpha antibody (FITC/PE/Cy5), anti T Cell Growth Factor Receptor antibody (FITC/PE/Cy5), anti TAC antigen antibody (FITC/PE/Cy5), anti TCGFR antibody (FITC/PE/Cy5)4770orb1216920 TestsCD3/CD4/CD45 antibody (FITC/PE/Cy5)anti CD 4 antibody (FITC/PE/Cy5), anti CD4 (L3T4) antibody (FITC/PE/Cy5), anti CD4 antibody (FITC/PE/Cy5), anti CD4 antigen (p55) antibody (FITC/PE/Cy5), anti CD4 Antigen antibody (FITC/PE/Cy5), anti CD4 molecule antibody (FITC/PE/Cy5), anti CD4 Receptor antibody (FITC/PE/Cy5), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE/Cy5), anti CD4mut antibody (FITC/PE/Cy5), anti L3T4 antibody (FITC/PE/Cy5), anti Leu3 antibody (FITC/PE/Cy5), anti Ly-4 antibody (FITC/PE/Cy5), anti Lymphocyte antigen CD4 antibody (FITC/PE/Cy5), anti T Cell Antigen T4 antibody (FITC/PE/Cy5), anti T cell antigen T4/LEU3 antibody (FITC/PE/Cy5), anti T cell differentiation antigen L3T4 antibody (FITC/PE/Cy5), anti T cell OKT4 deficiency, included antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE/Cy5), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE/Cy5), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE/Cy5), anti T-cell surface glycoprotein CD4 antibody (FITC/PE/Cy5), anti W3/25 antibody (FITC/PE/Cy5), anti W3/25 antigen antibody (FITC/PE/Cy5)2970orb1216950 TestsCD3/CD4/CD45 antibody (FITC/PE/Cy5)anti CD 4 antibody (FITC/PE/Cy5), anti CD4 (L3T4) antibody (FITC/PE/Cy5), anti CD4 antibody (FITC/PE/Cy5), anti CD4 antigen (p55) antibody (FITC/PE/Cy5), anti CD4 Antigen antibody (FITC/PE/Cy5), anti CD4 molecule antibody (FITC/PE/Cy5), anti CD4 Receptor antibody (FITC/PE/Cy5), anti CD4+ Lymphocyte deficiency, included antibody (FITC/PE/Cy5), anti CD4mut antibody (FITC/PE/Cy5), anti L3T4 antibody (FITC/PE/Cy5), anti Leu3 antibody (FITC/PE/Cy5), anti Ly-4 antibody (FITC/PE/Cy5), anti Lymphocyte antigen CD4 antibody (FITC/PE/Cy5), anti T Cell Antigen T4 antibody (FITC/PE/Cy5), anti T cell antigen T4/LEU3 antibody (FITC/PE/Cy5), anti T cell differentiation antigen L3T4 antibody (FITC/PE/Cy5), anti T cell OKT4 deficiency, included antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu 3 antibody (FITC/PE/Cy5), anti T Cell Surface Antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T cell surface antigen T4/Leu3 antibody (FITC/PE/Cy5), anti T Cell Surface Glycoprotein CD4 antibody (FITC/PE/Cy5), anti T-cell surface antigen T4/Leu-3 antibody (FITC/PE/Cy5), anti T-cell surface glycoprotein CD4 antibody (FITC/PE/Cy5), anti W3/25 antibody (FITC/PE/Cy5), anti W3/25 antigen antibody (FITC/PE/Cy5)4770orb442600.1 mgCD30 antibodyAnti-CD30 antibody, anti-Ki-1 antibody3960orb3039680.1 mgCD30 antibody3690orb273971 mlCD30 antibodyCD30, human6948Recombinant CD30, extracellular domainorb3021441 mlCD30 antibody6210orb3027881 mlCD30 antibody13410orb3720081 mlCD30 antibody7740orb302874100 ugCD30 antibody5850orb348857100 ugCD30 antibody3870Recombinant proteinorb348919100 ugCD30 antibody3870Recombinant proteinorb348920100 ugCD30 antibody3870Recombinant proteinorb348925100 ugCD30 antibody3870Recombinant proteinorb13314100 ugCD30 antibodyanti-ber-H2 antibody, anti-CD153 antibody, anti-CD30 antibody, anti-CD30gen antibody, anti-CD30L receptor antibody, anti-Cytokine receptor CD30 antibody, anti-D1S166E antibody, anti-Ki 1gen antibody, anti-KI-1 antibody, anti-Lymphocyte activationgen CD30 antibody, anti-TNFRSF8 antibody, anti-Tumor Nec antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 8 antibody2970Synthetic peptide (please contact us for details)orb13314200 ugCD30 antibodyanti-ber-H2 antibody, anti-CD153 antibody, anti-CD30 antibody, anti-CD30gen antibody, anti-CD30L receptor antibody, anti-Cytokine receptor CD30 antibody, anti-D1S166E antibody, anti-Ki 1gen antibody, anti-KI-1 antibody, anti-Lymphocyte activationgen CD30 antibody, anti-TNFRSF8 antibody, anti-Tumor Nec antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 8 antibody3870Synthetic peptide (please contact us for details)orb182885100 ugCD30 antibodyanti CD 30 antibody, anti CD30 antibody, anti CD30 antigen antibody, anti CD30L receptor antibody, anti Cytokine receptor CD30 antibody, anti D1S166E antibody, anti KI 1 antibody, anti KI 1 antigen antibody, anti Ki-1 antigen antibody, anti KI1 antibody, anti Lymphocyte activation antigen CD30 antibody, anti TNFRSF 8 antibody, anti TNFRSF8 antibody, anti TNR8_HUMAN antibody, anti Tumor necrosis factor receptor superfamily member 8 antibody2970KLH conjugated synthetic peptide derived from human CD30orb182885200 ugCD30 antibodyanti CD 30 antibody, anti CD30 antibody, anti CD30 antigen antibody, anti CD30L receptor antibody, anti Cytokine receptor CD30 antibody, anti D1S166E antibody, anti KI 1 antibody, anti KI 1 antigen antibody, anti Ki-1 antigen antibody, anti KI1 antibody, anti Lymphocyte activation antigen CD30 antibody, anti TNFRSF 8 antibody, anti TNFRSF8 antibody, anti TNR8_HUMAN antibody, anti Tumor necrosis factor receptor superfamily member 8 antibody3870KLH conjugated synthetic peptide derived from human CD30orb97429100 ulCD30 antibodyanti CD30 antibody, anti Ki-1 antibody, anti D1S166E antibody, anti TNFRSF8 antibody3960Purified recombinant fragment of human CD30 expressed in E. Coli.orb394501100 ulCD30 antibody3798Recombinant fragment of human CD30 expressed in E. Coliorb39450150 ulCD30 antibody3258Recombinant fragment of human CD30 expressed in E. Coliorb317424100 ulCD30 antibodyanti CD30 antibody antibody3960A Co cell line established from a patient with Hodgkin s disease of T-cell lineage was used as the immunogen for the CD30 antibody.orb317424500 ulCD30 antibodyanti CD30 antibody antibody5850A Co cell line established from a patient with Hodgkin s disease of T-cell lineage was used as the immunogen for the CD30 antibody.orb317425100 ulCD30 antibodyanti CD30 antibody antibody3960A Co cell line established from a patient with Hodgkin s disease of T-cell lineage was used as the immunogen for the CD30 antibody.orb317425500 ulCD30 antibodyanti CD30 antibody antibody5850A Co cell line established from a patient with Hodgkin s disease of T-cell lineage was used as the immunogen for the CD30 antibody.orb44263100 testsCD30 antibodyAnti-CD30 antibody, anti-Ki-1 antibody5670orb303969100 testsCD30 antibody5670orb24825120 ugCD30 antibodyanti CD30L receptor antibody, anti Ki-1 antigen antibody, anti Tumor necrosis factor receptor superfamily member 8 (TNFRSF8) antibody, anti CD30 antibody antibody3960Human CD30 recombinant protein was used as the immungen for this antibody.orb248251100 ugCD30 antibodyanti CD30L receptor antibody, anti Ki-1 antigen antibody, anti Tumor necrosis factor receptor superfamily member 8 (TNFRSF8) antibody, anti CD30 antibody antibody5850Human CD30 recombinant protein was used as the immungen for this antibody.orb31742620 ugCD30 antibodyanti CD30 antibody antibody3960Recombinant human protein was used as the immunogen for the CD30 antibody.orb317426100 ugCD30 antibodyanti CD30 antibody antibody5850Recombinant human protein was used as the immunogen for the CD30 antibody.orb31742720 ugCD30 antibodyanti CD30 antibody antibody3960Recombinant human protein was used as the immunogen for the CD30 antibody.orb317427100 ugCD30 antibodyanti CD30 antibody antibody5850Recombinant human protein was used as the immunogen for the CD30 antibody.orb38580020 ugCD30 antibody3960Recombinant human protein was used as the immunogen for the CD30 antibody.orb385800100 ugCD30 antibody5850Recombinant human protein was used as the immunogen for the CD30 antibody.orb38601720 ugCD30 antibody3960A partial human protein was used as the immunogen for the CD30 antibody.orb386017100 ugCD30 antibody5850A partial human protein was used as the immunogen for the CD30 antibody.orb38620520 ugCD30 antibody3960Recombinant full length human protein was used as the immunogen for the recombinant CD30 antibody.orb386205100 ugCD30 antibody5850Recombinant full length human protein was used as the immunogen for the recombinant CD30 antibody.orb38623120 ugCD30 antibody4500A human partial protein was used as the immunogen for the recombinant CD30 antibody.orb386231100 ugCD30 antibody6570A human partial protein was used as the immunogen for the recombinant CD30 antibody.orb38623220 ugCD30 antibody4500A partial human protein was used as the immunogen for the recombinant CD30 antibody.orb386232100 ugCD30 antibody6570A partial human protein was used as the immunogen for the recombinant CD30 antibody.orb170264200 ugCD30 antibodyanti TNFRSF8 antibody6030Recombinant Human CD30/TNFRSF8 protein. Produced in rabbits immunized with purified, recombinant Human CD30/TNFRSF8orb17026450 ugCD30 antibodyanti TNFRSF8 antibody3420Recombinant Human CD30/TNFRSF8 protein. Produced in rabbits immunized with purified, recombinant Human CD30/TNFRSF8orb170264100 ugCD30 antibodyanti TNFRSF8 antibody4680Recombinant Human CD30/TNFRSF8 protein. Produced in rabbits immunized with purified, recombinant Human CD30/TNFRSF8orb170267200 ugCD30 antibodyanti TNFRSF8 antibody6030Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb17026750 ugCD30 antibodyanti TNFRSF8 antibody3420Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb170267100 ugCD30 antibodyanti TNFRSF8 antibody4680Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb230339200 ugCD30 antibody6030orb23033950 ugCD30 antibody3420orb230339100 ugCD30 antibody4680orb230341200 ugCD30 antibody6030orb23034150 ugCD30 antibody3420orb230341100 ugCD30 antibody4680orb362730200 ugCD30 antibody6030A synthetic peptide corresponding to the center region of the mouse CD30/TNFRSF8orb36273050 ugCD30 antibody3420A synthetic peptide corresponding to the center region of the mouse CD30/TNFRSF8orb362730100 ugCD30 antibody4680A synthetic peptide corresponding to the center region of the mouse CD30/TNFRSF8orb170263400 ugCD30 antibodyanti TNFRSF8 antibody6030Recombinant Human CD30/TNFRSF8 protein. Produced in rabbits immunized with purified, recombinant Human CD30/TNFRSF8orb170263100 ugCD30 antibodyanti TNFRSF8 antibody3420Recombinant Human CD30/TNFRSF8 protein. Produced in rabbits immunized with purified, recombinant Human CD30/TNFRSF8orb170263200 ugCD30 antibodyanti TNFRSF8 antibody4680Recombinant Human CD30/TNFRSF8 protein. Produced in rabbits immunized with purified, recombinant Human CD30/TNFRSF8orb8771350 ugCD30 antibody6660orb17085850 ugCD30 antibodyanti TNFRSF8 antibody4050Recombinant Human CD30/TNFRSF8 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD30/TNFRSF8orb170858100 ugCD30 antibodyanti TNFRSF8 antibody6030Recombinant Human CD30/TNFRSF8 protein. This antibody was obtained from a rabbit immunized with purified, recombinant Human CD30/TNFRSF8orb23034250 ugCD30 antibody4050orb230342100 ugCD30 antibody6030orb111557100 ulCD30 antibody (Alexa 488)ber-H2 antibody (Alexa 488), CD153 antibody (Alexa 488), CD30 antibody (Alexa 488), CD30gen antibody (Alexa 488), CD30L receptor antibody (Alexa 488), Cytokine receptor CD30 antibody (Alexa 488), D1S166E antibody (Alexa 488), Ki 1gen antibody (Alexa 488), KI-1 antibody (Alexa 488), Lymphocyte activationgen CD30 antibody (Alexa 488), TNFRSF8 antibody (Alexa 488), Tumor Nec antibody (Alexa 488), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Alexa 488)3870Synthetic peptide (Please contact us for more details)orb111065100 ulCD30 antibody (Alexa Fluor 350)ber-H2 antibody (Alexa Fluor 350), CD153 antibody (Alexa Fluor 350), CD30 antibody (Alexa Fluor 350), CD30gen antibody (Alexa Fluor 350), CD30L receptor antibody (Alexa Fluor 350), Cytokine receptor CD30 antibody (Alexa Fluor 350), D1S166E antibody (Alexa Fluor 350), Ki 1gen antibody (Alexa Fluor 350), KI-1 antibody (Alexa Fluor 350), Lymphocyte activationgen CD30 antibody (Alexa Fluor 350), TNFRSF8 antibody (Alexa Fluor 350), Tumor Nec antibody (Alexa Fluor 350), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Alexa Fluor 350)3870Synthetic peptide (Please contact us for more details)orb113526100 ulCD30 antibody (Alkaline Phosphatase)ber-H2 antibody (Alkaline Phosphatase), CD153 antibody (Alkaline Phosphatase), CD30 antibody (Alkaline Phosphatase), CD30gen antibody (Alkaline Phosphatase), CD30L receptor antibody (Alkaline Phosphatase), Cytokine receptor CD30 antibody (Alkaline Phosphatase), D1S166E antibody (Alkaline Phosphatase), Ki 1gen antibody (Alkaline Phosphatase), KI-1 antibody (Alkaline Phosphatase), Lymphocyte activationgen CD30 antibody (Alkaline Phosphatase), TNFRSF8 antibody (Alkaline Phosphatase), Tumor Nec antibody (Alkaline Phosphatase), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Alkaline Phosphatase)3870Synthetic peptide (Please contact us for more details)orb23034050 TestsCD30 antibody (APC)4050orb230340100 TestsCD30 antibody (APC)6030orb114019100 ulCD30 antibody (Biotin)ber-H2 antibody (Biotin), CD153 antibody (Biotin), CD30 antibody (Biotin), CD30gen antibody (Biotin), CD30L receptor antibody (Biotin), Cytokine receptor CD30 antibody (Biotin), D1S166E antibody (Biotin), Ki 1gen antibody (Biotin), KI-1 antibody (Biotin), Lymphocyte activationgen CD30 antibody (Biotin), TNFRSF8 antibody (Biotin), Tumor Nec antibody (Biotin), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Biotin)3870Synthetic peptide (Please contact us for more details)orb114511100 ulCD30 antibody (Cy3)ber-H2 antibody (Cy3), CD153 antibody (Cy3), CD30 antibody (Cy3), CD30gen antibody (Cy3), CD30L receptor antibody (Cy3), Cytokine receptor CD30 antibody (Cy3), D1S166E antibody (Cy3), Ki 1gen antibody (Cy3), KI-1 antibody (Cy3), Lymphocyte activationgen CD30 antibody (Cy3), TNFRSF8 antibody (Cy3), Tumor Nec antibody (Cy3), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Cy3)3870Synthetic peptide (Please contact us for more details)orb122461100 ulCD30 antibody (Cy5)H2 antibody (Cy5), CD153 antibody (Cy5), CD30 antibody (Cy5), CD30gen antibody (Cy5), CD30L receptor antibody (Cy5), Cytokine receptor CD30 antibody (Cy5), D1S166E antibody (Cy5), Ki 1gen antibody (Cy5), KI-1 antibody (Cy5), Lymphocyte activationgen CD30 antibody (Cy5), TNFRSF8 antibody (Cy5), Tumor Nec antibody (Cy5), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Cy5)3870Synthetic peptide (Please contact us for more details)orb123044100 ulCD30 antibody (Cy5.5)H2 antibody (Cy5.5), CD153 antibody (Cy5.5), CD30 antibody (Cy5.5), CD30gen antibody (Cy5.5), CD30L receptor antibody (Cy5.5), Cytokine receptor CD30 antibody (Cy5.5), D1S166E antibody (Cy5.5), Ki 1gen antibody (Cy5.5), KI-1 antibody (Cy5.5), Lymphocyte activationgen CD30 antibody (Cy5.5), TNFRSF8 antibody (Cy5.5), Tumor Nec antibody (Cy5.5), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Cy5.5)3870Synthetic peptide (Please contact us for more details)orb123536100 ulCD30 antibody (Cy7)H2 antibody (Cy7), CD153 antibody (Cy7), CD30 antibody (Cy7), CD30gen antibody (Cy7), CD30L receptor antibody (Cy7), Cytokine receptor CD30 antibody (Cy7), D1S166E antibody (Cy7), Ki 1gen antibody (Cy7), KI-1 antibody (Cy7), Lymphocyte activationgen CD30 antibody (Cy7), TNFRSF8 antibody (Cy7), Tumor Nec antibody (Cy7), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (Cy7)3870Synthetic peptide (Please contact us for more details)orb13857100 ugCD30 antibody (FITC)anti-ber-H2 antibody, anti-CD153 antibody, anti-CD30 antibody, anti-CD30gen antibody, anti-CD30L receptor antibody, anti-Cytokine receptor CD30 antibody, anti-D1S166E antibody, anti-Ki 1gen antibody, anti-KI-1 antibody, anti-Lymphocyte activationgen CD30 antibody, anti-TNFRSF8 antibody, anti-Tumor Nec antibody, anti-Tumor Necrosis Factor Receptor Superfamily Member 8 antibody3870Synthetic peptide (please contact us for details)orb187198100 ugCD30 antibody (FITC)anti CD 30 antibody, anti CD30 antibody, anti CD30 antigen antibody, anti CD30L receptor antibody, anti Cytokine receptor CD30 antibody, anti D1S166E antibody, anti KI 1 antibody, anti KI 1 antigen antibody, anti Ki-1 antigen antibody, anti KI1 antibody, anti Lymphocyte activation antigen CD30 antibody, anti TNFRSF 8 antibody, anti TNFRSF8 antibody, anti TNR8_HUMAN antibody, anti Tumor necrosis factor receptor superfamily member 8 antibody3870KLH conjugated synthetic peptide derived from human CD30orb44261100 testsCD30 antibody (FITC)Anti-CD30 antibody, anti-Ki-1 antibody4770orb334040100 testsCD30 antibody (FITC)4770Human CD30orb17105550 TestsCD30 antibody (FITC)anti TNFRSF8 antibody4050Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb171055100 TestsCD30 antibody (FITC)anti TNFRSF8 antibody6030Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb110079100 ulCD30 antibody (HRP)ber-H2 antibody (HRP), CD153 antibody (HRP), CD30 antibody (HRP), CD30gen antibody (HRP), CD30L receptor antibody (HRP), Cytokine receptor CD30 antibody (HRP), D1S166E antibody (HRP), Ki 1gen antibody (HRP), KI-1 antibody (HRP), Lymphocyte activationgen CD30 antibody (HRP), TNFRSF8 antibody (HRP), Tumor Nec antibody (HRP), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (HRP)3870Synthetic peptide (Please contact us for more details)orb124520100 ulCD30 antibody (PE)H2 antibody (PE), CD153 antibody (PE), CD30 antibody (PE), CD30gen antibody (PE), CD30L receptor antibody (PE), Cytokine receptor CD30 antibody (PE), D1S166E antibody (PE), Ki 1gen antibody (PE), KI-1 antibody (PE), Lymphocyte activationgen CD30 antibody (PE), TNFRSF8 antibody (PE), Tumor Nec antibody (PE), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (PE)3870Synthetic peptide (Please contact us for more details)orb44262100 testsCD30 antibody (PE)Anti-CD30 antibody, anti-Ki-1 antibody5670orb17132050 TestsCD30 antibody (PE)anti TNFRSF8 antibody4050Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb171320100 TestsCD30 antibody (PE)anti TNFRSF8 antibody6030Recombinant Human CD30/TNFRSF8 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD30/TNFRSF8orb125297100 ulCD30 antibody (PE-Cy3)H2 antibody (PE-Cy3), CD153 antibody (PE-Cy3), CD30 antibody (PE-Cy3), CD30gen antibody (PE-Cy3), CD30L receptor antibody (PE-Cy3), Cytokine receptor CD30 antibody (PE-Cy3), D1S166E antibody (PE-Cy3), Ki 1gen antibody (PE-Cy3), KI-1 antibody (PE-Cy3), Lymphocyte activationgen CD30 antibody (PE-Cy3), TNFRSF8 antibody (PE-Cy3), Tumor Nec antibody (PE-Cy3), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (PE-Cy3)3870Synthetic peptide (Please contact us for more details)orb129799100 ulCD30 antibody (PE-Cy5)H2 antibody (PE-Cy5), CD153 antibody (PE-Cy5), CD30 antibody (PE-Cy5), CD30gen antibody (PE-Cy5), CD30L receptor antibody (PE-Cy5), Cytokine receptor CD30 antibody (PE-Cy5), D1S166E antibody (PE-Cy5), Ki 1gen antibody (PE-Cy5), KI-1 antibody (PE-Cy5), Lymphocyte activationgen CD30 antibody (PE-Cy5), TNFRSF8 antibody (PE-Cy5), Tumor Nec antibody (PE-Cy5), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (PE-Cy5)3870Synthetic peptide (Please contact us for more details)orb130291100 ulCD30 antibody (PE-Cy5.5)H2 antibody (PE-Cy5.5), CD153 antibody (PE-Cy5.5), CD30 antibody (PE-Cy5.5), CD30gen antibody (PE-Cy5.5), CD30L receptor antibody (PE-Cy5.5), Cytokine receptor CD30 antibody (PE-Cy5.5), D1S166E antibody (PE-Cy5.5), Ki 1gen antibody (PE-Cy5.5), KI-1 antibody (PE-Cy5.5), Lymphocyte activationgen CD30 antibody (PE-Cy5.5), TNFRSF8 antibody (PE-Cy5.5), Tumor Nec antibody (PE-Cy5.5), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (PE-Cy5.5)3870Synthetic peptide (Please contact us for more details)orb130783100 ulCD30 antibody (PE-Cy7)H2 antibody (PE-Cy7), CD153 antibody (PE-Cy7), CD30 antibody (PE-Cy7), CD30gen antibody (PE-Cy7), CD30L receptor antibody (PE-Cy7), Cytokine receptor CD30 antibody (PE-Cy7), D1S166E antibody (PE-Cy7), Ki 1gen antibody (PE-Cy7), KI-1 antibody (PE-Cy7), Lymphocyte activationgen CD30 antibody (PE-Cy7), TNFRSF8 antibody (PE-Cy7), Tumor Nec antibody (PE-Cy7), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (PE-Cy7)3870Synthetic peptide (Please contact us for more details)orb131275100 ulCD30 antibody (RBITC)H2 antibody (RBITC), CD153 antibody (RBITC), CD30 antibody (RBITC), CD30gen antibody (RBITC), CD30L receptor antibody (RBITC), Cytokine receptor CD30 antibody (RBITC), D1S166E antibody (RBITC), Ki 1gen antibody (RBITC), KI-1 antibody (RBITC), Lymphocyte activationgen CD30 antibody (RBITC), TNFRSF8 antibody (RBITC), Tumor Nec antibody (RBITC), Tumor Necrosis Factor Receptor Superfamily Member 8 antibody (RBITC)3870Synthetic peptide (Please contact us for more details)orb317428100 ulCD30 Cocktail antibodyanti CD30 Cocktail antibody antibody3960A Co cell line established from a patient with Hodgkinorb317428500 ulCD30 Cocktail antibodyanti CD30 Cocktail antibody antibody5850A Co cell line established from a patient with Hodgkinorb302727100 ugCD300 antibody5850orb442480.1 mgCD300a antibodyAnti-CD300a antibody4140orb337272100 ulCD300A antibody3798A synthesized peptide derived from human CD300Aorb33727250 ulCD300A antibody3258A synthesized peptide derived from human CD300Aorb170295200 ugCD300A antibody6030Recombinant Human CD300A protein. Produced in rabbits immunized with purified, recombinant Human CD300Aorb17029550 ugCD300A antibody3420Recombinant Human CD300A protein. Produced in rabbits immunized with purified, recombinant Human CD300Aorb170295100 ugCD300A antibody4680Recombinant Human CD300A protein. Produced in rabbits immunized with purified, recombinant Human CD300Aorb361924200 ugCD300A antibody6030Recombinant human CD300A Protein orb36192450 ugCD300A antibody3420Recombinant human CD300A Protein orb361924100 ugCD300A antibody4680Recombinant human CD300A Protein orb230853400 ugCD300A antibody6030orb230853100 ugCD300A antibody3420orb230853200 ugCD300A antibody4680orb4131450 ulCD300A antibody2520Recombinant human CMRF35-like molecule 8 proteinorb41314100 ulCD300A antibody3420Recombinant human CMRF35-like molecule 8 proteinorb4131550 ulCD300A antibody2520Recombinant human CMRF35-like molecule 8 proteinorb41315100 ulCD300A antibody3420Recombinant human CMRF35-like molecule 8 proteinorb23085050 TestsCD300A antibody (APC)4050orb230850100 TestsCD300A antibody (APC)6030orb23085150 TestsCD300A antibody (FITC)4050orb230851100 TestsCD300A antibody (FITC)6030orb44249100 testsCD300a antibody (PE)Anti-CD300a antibody5670orb23085250 TestsCD300A antibody (PE)4050orb230852100 TestsCD300A antibody (PE)6030orb146644100 ugCD300C antibody6030orb14664450 ugCD300C antibody4050orb311525100 ulCD300c antibody4716KLH Conjugated synthetic peptideorb146642200 ugCD300C antibody6030orb146642100 ugCD300C antibody4680orb14664250 ugCD300C antibody3420orb146643200 ugCD300C antibody6030orb146643100 ugCD300C antibody4680orb14664350 ugCD300C antibody3420orb361889200 ugCD300C antibody6030Recombinant human CD300C Protein orb36188950 ugCD300C antibody3420Recombinant human CD300C Protein orb361889100 ugCD300C antibody4680Recombinant human CD300C Protein orb339137200 ulCD300c antibodyanti CMRF35 antibody, anti CMRF35A antibody, anti CMRF35A1 antibody, anti IGSF16 antibody, anti CMRF35-like molecule 6 antibody, anti CLM-6 antibody, anti CD300 antigen-like family member C antibody, anti CMRF35-A1 antibody, anti CMRF-35 antibody, anti Immunoglobulin superfamily member 16 antibody, anti IgSF16 antibody, anti CD300c antibody4320orb339137100 ulCD300c antibodyanti CMRF35 antibody, anti CMRF35A antibody, anti CMRF35A1 antibody, anti IGSF16 antibody, anti CMRF35-like molecule 6 antibody, anti CLM-6 antibody, anti CD300 antigen-like family member C antibody, anti CMRF35-A1 antibody, anti CMRF-35 antibody, anti Immunoglobulin superfamily member 16 antibody, anti IgSF16 antibody, anti CD300c antibody3870orb374626200 ulCD300C antibody6480Recombinant protein of human CD300Corb37462650 ulCD300C antibody3060Recombinant protein of human CD300Corb374626100 ulCD300C antibody4140Recombinant protein of human CD300Corb230703400 ugCD300C antibody6030orb230703100 ugCD300C antibody3420orb230703200 ugCD300C antibody4680orb164396400 ulCD300C antibodyAnti CD300C antibody, anti CMRF35 antibody, anti CMRF35A antibody, anti CMRF35A1 antibody, anti IGSF16 antibody, anti CMRF35-like molecule 6 antibody, anti CD300 antigen-like family member C antibody, anti CMRF35-A1 antibody, anti Immunoglobulin superfamily member 16 antibody, anti CD_antigen=CD300c antibody, anti Flags: Precursor antibody4050This CD300C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 195-224 amino acids from the C-terminal region of human CD300C.orb36285250 ugCD300C antibody4050Recombinant human CD300C Protein orb362852100 ugCD300C antibody6030Recombinant human CD300C Protein orb23070250 TestsCD300C antibody (APC)4050orb230702100 TestsCD300C antibody (APC)6030orb146645100 TestsCD300C antibody (FITC)6030orb14664550 TestsCD300C antibody (FITC)4050orb146646100 TestsCD300C antibody (PE)6030orb14664650 TestsCD300C antibody (PE)4050orb311541100 ulCD300d antibody4716KLH Conjugated synthetic peptideorb166056400 ulCD300E (Center) antibodyAnti CD300E antibody, anti CD300LE antibody, anti CLM2 antibody, anti CMRF35A5 antibody, anti IREM2 antibody, anti CMRF35-like molecule 2 antibody, anti CD300 antigen-like family member E antibody, anti CMRF35-A5 antibody, anti Immune receptor expressed on myeloid cells 2 antibody, anti Polymeric immunoglobulin receptor 2 antibody, anti CD_antigen=CD300e antibody, anti Flags: Precursor antibody4050This CD300E antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 48-76 amino acids from the Central region of human CD300E.orb1798790.1 mgCD300e antibody3690CD300e-HA-transfected cellsorb362789200 ugCD300E antibody6030A synthetic peptide corresponding to the center region of the human CD300E/CMRF35-A5orb36278950 ugCD300E antibody3420A synthetic peptide corresponding to the center region of the human CD300E/CMRF35-A5orb362789100 ugCD300E antibody4680A synthetic peptide corresponding to the center region of the human CD300E/CMRF35-A5orb179877100 TestsCD300e antibody (APC)5670CD300e-HA-transfected cellsorb179878100 TestsCD300e antibody (PE)5670CD300e-HA-transfected cellsorb160320100 ugCD300f antibody2970Synthesized peptide derived from the Internal region of human CD300f.orb311220100 ulCD300g antibody4716KLH Conjugated synthetic peptideorb336342100 ulCD300LB antibody3798A synthesized peptide derived from human CD300LBorb33634250 ulCD300LB antibody3258A synthesized peptide derived from human CD300LBorb35500400 ulCD300LB antibodyAnti-CD_antigen=CD300b antibody, anti-Flags: Precursor antibody, anti-CD300 antigen-like family member B antibody, anti-Leukocyte mono-Ig-like receptor 5 antibody, anti-Triggering receptor expressed on myeloid cells 5 antibody, anti-TREM-5 antibody, anti-Immune receptor expressed on myeloid cells 3 antibody, anti-IREM-3 antibody, anti-CMRF35-A2 antibody, anti-CMRF35-like molecule 7 antibody, anti-CLM-7, UNQ2530/PRO6029 antibody, anti-TREM5 antibody, anti-LMIR5 antibody, anti-IREM3 antibody, anti-CMRF35A2 antibody, anti-CLM7 antibody, anti-CD300B antibody, anti-CD300LB antibody4050Immunogen is CD300LB (N-term).orb2302550 ugCD300LB antibody3420Recombinant human CMRF35-like molecule 7 proteinorb23025100 ugCD300LB antibody5130Recombinant human CMRF35-like molecule 7 proteinorb2303350 ugCD300LB antibody (Biotin)3420Recombinant human CMRF35-like molecule 7 proteinorb23033100 ugCD300LB antibody (Biotin)5130Recombinant human CMRF35-like molecule 7 proteinorb2303150 ugCD300LB antibody (FITC)3420Recombinant human CMRF35-like molecule 7 proteinorb23031100 ugCD300LB antibody (FITC)5130Recombinant human CMRF35-like molecule 7 proteinorb2302650 ugCD300LB antibody (HRP)3420Recombinant human CMRF35-like molecule 7 proteinorb23026100 ugCD300LB antibody (HRP)5130Recombinant human CMRF35-like molecule 7 proteinorb318853200 ulCD300LD antibodyanti CD300D antibody, anti CMRF35A4 antibody, anti CMRF35-like molecule 4 antibody, anti CLM-4 antibody, anti CD300 antigen-like family member D antibody, anti CMRF35-A4 antibody, anti CD300d antibody4320orb318853100 ulCD300LD antibodyanti CD300D antibody, anti CMRF35A4 antibody, anti CMRF35-like molecule 4 antibody, anti CLM-4 antibody, anti CD300 antigen-like family member D antibody, anti CMRF35-A4 antibody, anti CD300d antibody3060orb361742200 ugCD300LF antibody6030A synthetic peptide corresponding to the center region of the human CD300LF/LMIR3orb36174250 ugCD300LF antibody3420A synthetic peptide corresponding to the center region of the human CD300LF/LMIR3orb361742100 ugCD300LF antibody4680A synthetic peptide corresponding to the center region of the human CD300LF/LMIR3orb319075200 ulCD300LF antibodyanti CD300F antibody, anti CLM1 antibody, anti IGSF13 antibody, anti IREM1 antibody, anti NKIR antibody, anti CMRF35-like molecule 1 antibody, anti CLM-1 antibody, anti CD300 antigen-like family member F antibody, anti Immune receptor expressed on myeloid cells 1 antibody, anti IREM-1 antibody, anti Immunoglobulin superfamily member 13 antibody, anti IgSF13 antibody, anti NK inhibitory receptor antibody, anti CD300f antibody4320orb319075100 ulCD300LF antibodyanti CD300F antibody, anti CLM1 antibody, anti IGSF13 antibody, anti IREM1 antibody, anti NKIR antibody, anti CMRF35-like molecule 1 antibody, anti CLM-1 antibody, anti CD300 antigen-like family member F antibody, anti Immune receptor expressed on myeloid cells 1 antibody, anti IREM-1 antibody, anti Immunoglobulin superfamily member 13 antibody, anti IgSF13 antibody, anti NK inhibitory receptor antibody, anti CD300f antibody3060orb35242950 ugCD300LF antibodyanti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody3420Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb352429100 ugCD300LF antibodyanti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody5130Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb35243250 ugCD300LF antibody (Biotin)anti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody3420Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb352432100 ugCD300LF antibody (Biotin)anti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody5130Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb35243150 ugCD300LF antibody (FITC)anti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody3420Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb352431100 ugCD300LF antibody (FITC)anti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody5130Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb35243050 ugCD300LF antibody (HRP)anti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody3420Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb352430100 ugCD300LF antibody (HRP)anti-CD300 antigen-like family member F antibody, anti-Immune receptor expressed on myeloid cells 1 antibody, anti-IREM-1 antibody, anti-Immunoglobulin superfamily member 13 antibody, anti-IgSF13 antibody, anti-NK inhibitory receptor antibody, anti-CD300f antibody, anti-CD300F antibody, anti-CLM1 antibody, anti-IGSF13 antibody, anti-IREM1 antibody, anti-NKIR antibody, anti-CD300LF antibody, anti-UNQ3105/PRO10111 antibody5130Recombinant human CMRF35-like molecule 1 protein(20-156AA)orb227307100 ulCD300LG antibody3798A synthesized peptideorb22730720 ulCD300LG antibody2736A synthesized peptideorb22730750 ulCD300LG antibody3258A synthesized peptideorb263910.25 mgCD301 antibodyAnti-CD301 (MGL, DC-ASGPR) antibody, anti-CD301 (MGL, DC-ASGPR) Primary antibodies, anti-Rat anti Mouse CD301 antibody, CD301 (MGL, DC-ASGPR) Primary antibodies, CD301 (MGL, DC-ASGPR) is a monoclonal antibody to non-human cds.10404Balb/c macrophage precursor cell hybridsorb394887100 ugCD301 antibody6552C-type lectin domain family 10, member Aorb127822100 ugCD302 antibody2880Synthesized peptide derived from internal of human CD302.orb127822200 ugCD302 antibody4140Synthesized peptide derived from internal of human CD302.orb194090100 ulCD302 antibodyanti CD302 antigen [Precursor] antibody, anti C-type lectin domain family 13 member A antibody, anti C-type lectin BIMLEC antibody, anti Type I transmembrane C-type lectin receptor DCL-1 antibody, anti CD302 antibody4716Synthesized peptide derived from internal of human CD302.orb231607200 ugCD302 antibody6030orb23160750 ugCD302 antibody3420orb231607100 ugCD302 antibody4680orb231606400 ugCD302 antibody6030orb231606100 ugCD302 antibody3420orb231606200 ugCD302 antibody4680orb23160550 ugCD302 antibody4050orb231605100 ugCD302 antibody6030orb3457250 ugCD302 antibody3420Recombinant human CD302 antigen proteinorb34572100 ugCD302 antibody5130Recombinant human CD302 antigen proteinorb3457550 ugCD302 antibody (Biotin)3420Recombinant human CD302 antigen proteinorb34575100 ugCD302 antibody (Biotin)5130Recombinant human CD302 antigen proteinorb3457450 ugCD302 antibody (FITC)3420Recombinant human CD302 antigen proteinorb34574100 ugCD302 antibody (FITC)5130Recombinant human CD302 antigen proteinorb3457350 ugCD302 antibody (HRP)3420Recombinant human CD302 antigen proteinorb34573100 ugCD302 antibody (HRP)5130Recombinant human CD302 antigen proteinorb13622100 ugCD303 antibodyAnti-BDCA-2 antibody, anti-CLEC4C antibody, anti-BDCA2 antibody, anti-Blood dendritic cell antigen 2 antibody, anti-Blood dendritic cell antigen 2 protein antibody, anti-C-type (calcium dependent antibody, anti-carbohydrate-recognition domain) lectin antibody, anti-superfamily member 11 antibody, anti-C-type (calcium dependent antibody, anti-carbohydrate-recognition domain) lectin antibody, anti-superfamily member 7 antibody, anti-C-type lectin domain family 4 member C antibody, anti-C-type lectin domain family 4 antibody, anti-member C antibody, anti-isoform 1 antibody, anti-C-type lectin superfamily member 7 antibody, anti-CD303 antibody, anti-CD303 antigen antibody, anti-CLECSF11 antibody, anti-CLECSF7 antibody, anti-Dendritic cell lectin antibody, anti-dendritic cell lectin b antibody, anti-Dendritic lectin antibody, anti-DLEC antibody, anti-HECL antibody, anti-Lectin antibody, anti-C-type antibody, anti-superfamily member 11 antibody, anti-MGC125789 antibody, anti-MGC125791 antibody, anti-MGC125792 antibody, anti-MGC125793 antibody, anti-PRO34150 antibody.3330orb13622200 ugCD303 antibodyAnti-BDCA-2 antibody, anti-CLEC4C antibody, anti-BDCA2 antibody, anti-Blood dendritic cell antigen 2 antibody, anti-Blood dendritic cell antigen 2 protein antibody, anti-C-type (calcium dependent antibody, anti-carbohydrate-recognition domain) lectin antibody, anti-superfamily member 11 antibody, anti-C-type (calcium dependent antibody, anti-carbohydrate-recognition domain) lectin antibody, anti-superfamily member 7 antibody, anti-C-type lectin domain family 4 member C antibody, anti-C-type lectin domain family 4 antibody, anti-member C antibody, anti-isoform 1 antibody, anti-C-type lectin superfamily member 7 antibody, anti-CD303 antibody, anti-CD303 antigen antibody, anti-CLECSF11 antibody, anti-CLECSF7 antibody, anti-Dendritic cell lectin antibody, anti-dendritic cell lectin b antibody, anti-Dendritic lectin antibody, anti-DLEC antibody, anti-HECL antibody, anti-Lectin antibody, anti-C-type antibody, anti-superfamily member 11 antibody, anti-MGC125789 antibody, anti-MGC125791 antibody, anti-MGC125792 antibody, anti-MGC125793 antibody, anti-PRO34150 antibody.4500orb111588100 ulCD303 antibody (Alexa 488)BDCA-2 antibody (Alexa 488), CLEC4C antibody (Alexa 488), BDCA2 antibody (Alexa 488), Blood dendritic cell antigen 2 antibody (Alexa 488), Blood dendritic cell antigen 2 protein antibody (Alexa 488), C-type (calcium dependent antibody (Alexa 488), carbohydrate-recognition domain) lectin antibody (Alexa 488), superfamily member 11 antibody (Alexa 488), C-type (calcium dependent antibody (Alexa 488), carbohydrate-recognition domain) lectin antibody (Alexa 488), superfamily member 7 antibody (Alexa 488), C-type lectin domain family 4 member C antibody (Alexa 488), C-type lectin domain family 4 antibody (Alexa 488), member C antibody (Alexa 488), isoform 1 antibody (Alexa 488), C-type lectin superfamily member 7 antibody (Alexa 488), CD303 antibody (Alexa 488), CD303 antigen antibody (Alexa 488), CLECSF11 antibody (Alexa 488), CLECSF7 antibody (Alexa 488), Dendritic cell lectin antibody (Alexa 488), dendritic cell lectin b antibody (Alexa 488), Dendritic lectin antibody (Alexa 488), DLEC antibody (Alexa 488), HECL antibody (Alexa 488), Lectin antibody (Alexa 488), C-type antibody (Alexa 488), superfamily member 11 antibody (Alexa 488), MGC125789 antibody (Alexa 488), MGC125791 antibody (Alexa 488), MGC125792 antibody (Alexa 488), MGC125793 antibody (Alexa 488), PRO34150 antibody (Alexa 488).3870Synthetic peptide (Please contact us for more details)orb111096100 ulCD303 antibody (Alexa Fluor 350)BDCA-2 antibody (Alexa Fluor 350), CLEC4C antibody (Alexa Fluor 350), BDCA2 antibody (Alexa Fluor 350), Blood dendritic cell antigen 2 antibody (Alexa Fluor 350), Blood dendritic cell antigen 2 protein antibody (Alexa Fluor 350), C-type (calcium dependent antibody (Alexa Fluor 350), carbohydrate-recognition domain) lectin antibody (Alexa Fluor 350), superfamily member 11 antibody (Alexa Fluor 350), C-type (calcium dependent antibody (Alexa Fluor 350), carbohydrate-recognition domain) lectin antibody (Alexa Fluor 350), superfamily member 7 antibody (Alexa Fluor 350), C-type lectin domain family 4 member C antibody (Alexa Fluor 350), C-type lectin domain family 4 antibody (Alexa Fluor 350), member C antibody (Alexa Fluor 350), isoform 1 antibody (Alexa Fluor 350), C-type lectin superfamily member 7 antibody (Alexa Fluor 350), CD303 antibody (Alexa Fluor 350), CD303 antigen antibody (Alexa Fluor 350), CLECSF11 antibody (Alexa Fluor 350), CLECSF7 antibody (Alexa Fluor 350), Dendritic cell lectin antibody (Alexa Fluor 350), dendritic cell lectin b antibody (Alexa Fluor 350), Dendritic lectin antibody (Alexa Fluor 350), DLEC antibody (Alexa Fluor 350), HECL antibody (Alexa Fluor 350), Lectin antibody (Alexa Fluor 350), C-type antibody (Alexa Fluor 350), superfamily member 11 antibody (Alexa Fluor 350), MGC125789 antibody (Alexa Fluor 350), MGC125791 antibody (Alexa Fluor 350), MGC125792 antibody (Alexa Fluor 350), MGC125793 antibody (Alexa Fluor 350), PRO34150 antibody (Alexa Fluor 350).3870Synthetic peptide (Please contact us for more details)orb113557100 ulCD303 antibody (Alkaline Phosphatase)BDCA-2 antibody (Alkaline Phosphatase), CLEC4C antibody (Alkaline Phosphatase), BDCA2 antibody (Alkaline Phosphatase), Blood dendritic cell antigen 2 antibody (Alkaline Phosphatase), Blood dendritic cell antigen 2 protein antibody (Alkaline Phosphatase), C-type (calcium dependent antibody (Alkaline Phosphatase), carbohydrate-recognition domain) lectin antibody (Alkaline Phosphatase), superfamily member 11 antibody (Alkaline Phosphatase), C-type (calcium dependent antibody (Alkaline Phosphatase), carbohydrate-recognition domain) lectin antibody (Alkaline Phosphatase), superfamily member 7 antibody (Alkaline Phosphatase), C-type lectin domain family 4 member C antibody (Alkaline Phosphatase), C-type lectin domain family 4 antibody (Alkaline Phosphatase), member C antibody (Alkaline Phosphatase), isoform 1 antibody (Alkaline Phosphatase), C-type lectin superfamily member 7 antibody (Alkaline Phosphatase), CD303 antibody (Alkaline Phosphatase), CD303 antigen antibody (Alkaline Phosphatase), CLECSF11 antibody (Alkaline Phosphatase), CLECSF7 antibody (Alkaline Phosphatase), Dendritic cell lectin antibody (Alkaline Phosphatase), dendritic cell lectin b antibody (Alkaline Phosphatase), Dendritic lectin antibody (Alkaline Phosphatase), DLEC antibody (Alkaline Phosphatase), HECL antibody (Alkaline Phosphatase), Lectin antibody (Alkaline Phosphatase), C-type antibody (Alkaline Phosphatase), superfamily member 11 antibody (Alkaline Phosphatase), MGC125789 antibody (Alkaline Phosphatase), MGC125791 antibody (Alkaline Phosphatase), MGC125792 antibody (Alkaline Phosphatase), MGC125793 antibody (Alkaline Phosphatase), PRO34150 antibody (Alkaline Phosphatase).3870Synthetic peptide (Please contact us for more details)orb114050100 ulCD303 antibody (Biotin)BDCA-2 antibody (Biotin), CLEC4C antibody (Biotin), BDCA2 antibody (Biotin), Blood dendritic cell antigen 2 antibody (Biotin), Blood dendritic cell antigen 2 protein antibody (Biotin), C-type (calcium dependent antibody (Biotin), carbohydrate-recognition domain) lectin antibody (Biotin), superfamily member 11 antibody (Biotin), C-type (calcium dependent antibody (Biotin), carbohydrate-recognition domain) lectin antibody (Biotin), superfamily member 7 antibody (Biotin), C-type lectin domain family 4 member C antibody (Biotin), C-type lectin domain family 4 antibody (Biotin), member C antibody (Biotin), isoform 1 antibody (Biotin), C-type lectin superfamily member 7 antibody (Biotin), CD303 antibody (Biotin), CD303 antigen antibody (Biotin), CLECSF11 antibody (Biotin), CLECSF7 antibody (Biotin), Dendritic cell lectin antibody (Biotin), dendritic cell lectin b antibody (Biotin), Dendritic lectin antibody (Biotin), DLEC antibody (Biotin), HECL antibody (Biotin), Lectin antibody (Biotin), C-type antibody (Biotin), superfamily member 11 antibody (Biotin), MGC125789 antibody (Biotin), MGC125791 antibody (Biotin), MGC125792 antibody (Biotin), MGC125793 antibody (Biotin), PRO34150 antibody (Biotin).3870Synthetic peptide (Please contact us for more details)orb114542100 ulCD303 antibody (Cy3)BDCA-2 antibody (Cy3), CLEC4C antibody (Cy3), BDCA2 antibody (Cy3), Blood dendritic cell antigen 2 antibody (Cy3), Blood dendritic cell antigen 2 protein antibody (Cy3), C-type (calcium dependent antibody (Cy3), carbohydrate-recognition domain) lectin antibody (Cy3), superfamily member 11 antibody (Cy3), C-type (calcium dependent antibody (Cy3), carbohydrate-recognition domain) lectin antibody (Cy3), superfamily member 7 antibody (Cy3), C-type lectin domain family 4 member C antibody (Cy3), C-type lectin domain family 4 antibody (Cy3), member C antibody (Cy3), isoform 1 antibody (Cy3), C-type lectin superfamily member 7 antibody (Cy3), CD303 antibody (Cy3), CD303 antigen antibody (Cy3), CLECSF11 antibody (Cy3), CLECSF7 antibody (Cy3), Dendritic cell lectin antibody (Cy3), dendritic cell lectin b antibody (Cy3), Dendritic lectin antibody (Cy3), DLEC antibody (Cy3), HECL antibody (Cy3), Lectin antibody (Cy3), C-type antibody (Cy3), superfamily member 11 antibody (Cy3), MGC125789 antibody (Cy3), MGC125791 antibody (Cy3), MGC125792 antibody (Cy3), MGC125793 antibody (Cy3), PRO34150 antibody (Cy3).3870Synthetic peptide (Please contact us for more details)orb122583100 ulCD303 antibody (Cy5)BDCA-2 antibody (Cy5), CLEC4C antibody (Cy5), BDCA2 antibody (Cy5), Blood dendritic cell antigen 2 antibody (Cy5), Blood dendritic cell antigen 2 protein antibody (Cy5), C-type (calcium dependent antibody (Cy5), carbohydrate-recognition domain) lectin antibody (Cy5), superfamily member 11 antibody (Cy5), C-type (calcium dependent antibody (Cy5), carbohydrate-recognition domain) lectin antibody (Cy5), superfamily member 7 antibody (Cy5), C-type lectin domain family 4 member C antibody (Cy5), C-type lectin domain family 4 antibody (Cy5), member C antibody (Cy5), isoform 1 antibody (Cy5), C-type lectin superfamily member 7 antibody (Cy5), CD303 antibody (Cy5), CD303 antigen antibody (Cy5), CLECSF11 antibody (Cy5), CLECSF7 antibody (Cy5), Dendritic cell lectin antibody (Cy5), dendritic cell lectin b antibody (Cy5), Dendritic lectin antibody (Cy5), DLEC antibody (Cy5), HECL antibody (Cy5), Lectin antibody (Cy5), C-type antibody (Cy5), superfamily member 11 antibody (Cy5), MGC125789 antibody (Cy5), MGC125791 antibody (Cy5), MGC125792 antibody (Cy5), MGC125793 antibody (Cy5), PRO34150 antibody (Cy5).3870Synthetic peptide (Please contact us for more details)orb123075100 ulCD303 antibody (Cy5.5)BDCA-2 antibody (Cy5.5), CLEC4C antibody (Cy5.5), BDCA2 antibody (Cy5.5), Blood dendritic cell antigen 2 antibody (Cy5.5), Blood dendritic cell antigen 2 protein antibody (Cy5.5), C-type (calcium dependent antibody (Cy5.5), carbohydrate-recognition domain) lectin antibody (Cy5.5), superfamily member 11 antibody (Cy5.5), C-type (calcium dependent antibody (Cy5.5), carbohydrate-recognition domain) lectin antibody (Cy5.5), superfamily member 7 antibody (Cy5.5), C-type lectin domain family 4 member C antibody (Cy5.5), C-type lectin domain family 4 antibody (Cy5.5), member C antibody (Cy5.5), isoform 1 antibody (Cy5.5), C-type lectin superfamily member 7 antibody (Cy5.5), CD303 antibody (Cy5.5), CD303 antigen antibody (Cy5.5), CLECSF11 antibody (Cy5.5), CLECSF7 antibody (Cy5.5), Dendritic cell lectin antibody (Cy5.5), dendritic cell lectin b antibody (Cy5.5), Dendritic lectin antibody (Cy5.5), DLEC antibody (Cy5.5), HECL antibody (Cy5.5), Lectin antibody (Cy5.5), C-type antibody (Cy5.5), superfamily member 11 antibody (Cy5.5), MGC125789 antibody (Cy5.5), MGC125791 antibody (Cy5.5), MGC125792 antibody (Cy5.5), MGC125793 antibody (Cy5.5), PRO34150 antibody (Cy5.5).3870Synthetic peptide (Please contact us for more details)orb123567100 ulCD303 antibody (Cy7)BDCA-2 antibody (Cy7), CLEC4C antibody (Cy7), BDCA2 antibody (Cy7), Blood dendritic cell antigen 2 antibody (Cy7), Blood dendritic cell antigen 2 protein antibody (Cy7), C-type (calcium dependent antibody (Cy7), carbohydrate-recognition domain) lectin antibody (Cy7), superfamily member 11 antibody (Cy7), C-type (calcium dependent antibody (Cy7), carbohydrate-recognition domain) lectin antibody (Cy7), superfamily member 7 antibody (Cy7), C-type lectin domain family 4 member C antibody (Cy7), C-type lectin domain family 4 antibody (Cy7), member C antibody (Cy7), isoform 1 antibody (Cy7), C-type lectin superfamily member 7 antibody (Cy7), CD303 antibody (Cy7), CD303 antigen antibody (Cy7), CLECSF11 antibody (Cy7), CLECSF7 antibody (Cy7), Dendritic cell lectin antibody (Cy7), dendritic cell lectin b antibody (Cy7), Dendritic lectin antibody (Cy7), DLEC antibody (Cy7), HECL antibody (Cy7), Lectin antibody (Cy7), C-type antibody (Cy7), superfamily member 11 antibody (Cy7), MGC125789 antibody (Cy7), MGC125791 antibody (Cy7), MGC125792 antibody (Cy7), MGC125793 antibody (Cy7), PRO34150 antibody (Cy7).3870Synthetic peptide (Please contact us for more details)orb397146100 ugCD303 antibody (FITC)Anti-BDCA-2 antibody, anti-CLEC4C antibody, anti-BDCA2 antibody, anti-Blood dendritic cell antigen 2 antibody, anti-Blood dendritic cell antigen 2 protein antibody, anti-C-type (calcium dependent antibody, anti-carbohydrate-recognition domain) lectin antibody, anti-superfamily member 11 antibody, anti-C-type (calcium dependent antibody, anti-carbohydrate-recognition domain) lectin antibody, anti-superfamily member 7 antibody, anti-C-type lectin domain family 4 member C antibody, anti-C-type lectin domain family 4 antibody, anti-member C antibody, anti-isoform 1 antibody, anti-C-type lectin superfamily member 7 antibody, anti-CD303 antibody, anti-CD303 antigen antibody, anti-CLECSF11 antibody, anti-CLECSF7 antibody, anti-Dendritic cell lectin antibody, anti-dendritic cell lectin b antibody, anti-Dendritic lectin antibody, anti-DLEC antibody, anti-HECL antibody, anti-Lectin antibody, anti-C-type antibody, anti-superfamily member 11 antibody, anti-MGC125789 antibody, anti-MGC125791 antibody, anti-MGC125792 antibody, anti-MGC125793 antibody, anti-PRO34150 antibody.3330KLH conjugated synthetic peptide derived from human CD303.orb110110100 ulCD303 antibody (HRP)BDCA-2 antibody (HRP), CLEC4C antibody (HRP), BDCA2 antibody (HRP), Blood dendritic cell antigen 2 antibody (HRP), Blood dendritic cell antigen 2 protein antibody (HRP), C-type (calcium dependent antibody (HRP), carbohydrate-recognition domain) lectin antibody (HRP), superfamily member 11 antibody (HRP), C-type (calcium dependent antibody (HRP), carbohydrate-recognition domain) lectin antibody (HRP), superfamily member 7 antibody (HRP), C-type lectin domain family 4 member C antibody (HRP), C-type lectin domain family 4 antibody (HRP), member C antibody (HRP), isoform 1 antibody (HRP), C-type lectin superfamily member 7 antibody (HRP), CD303 antibody (HRP), CD303 antigen antibody (HRP), CLECSF11 antibody (HRP), CLECSF7 antibody (HRP), Dendritic cell lectin antibody (HRP), dendritic cell lectin b antibody (HRP), Dendritic lectin antibody (HRP), DLEC antibody (HRP), HECL antibody (HRP), Lectin antibody (HRP), C-type antibody (HRP), superfamily member 11 antibody (HRP), MGC125789 antibody (HRP), MGC125791 antibody (HRP), MGC125792 antibody (HRP), MGC125793 antibody (HRP), PRO34150 antibody (HRP).3870Synthetic peptide (Please contact us for more details)orb124551100 ulCD303 antibody (PE)BDCA-2 antibody (PE), CLEC4C antibody (PE), BDCA2 antibody (PE), Blood dendritic cell antigen 2 antibody (PE), Blood dendritic cell antigen 2 protein antibody (PE), C-type (calcium dependent antibody (PE), carbohydrate-recognition domain) lectin antibody (PE), superfamily member 11 antibody (PE), C-type (calcium dependent antibody (PE), carbohydrate-recognition domain) lectin antibody (PE), superfamily member 7 antibody (PE), C-type lectin domain family 4 member C antibody (PE), C-type lectin domain family 4 antibody (PE), member C antibody (PE), isoform 1 antibody (PE), C-type lectin superfamily member 7 antibody (PE), CD303 antibody (PE), CD303 antigen antibody (PE), CLECSF11 antibody (PE), CLECSF7 antibody (PE), Dendritic cell lectin antibody (PE), dendritic cell lectin b antibody (PE), Dendritic lectin antibody (PE), DLEC antibody (PE), HECL antibody (PE), Lectin antibody (PE), C-type antibody (PE), superfamily member 11 antibody (PE), MGC125789 antibody (PE), MGC125791 antibody (PE), MGC125792 antibody (PE), MGC125793 antibody (PE), PRO34150 antibody (PE).3870Synthetic peptide (Please contact us for more details)orb129072100 ulCD303 antibody (PE-Cy3)BDCA-2 antibody (PE-Cy3), CLEC4C antibody (PE-Cy3), BDCA2 antibody (PE-Cy3), Blood dendritic cell antigen 2 antibody (PE-Cy3), Blood dendritic cell antigen 2 protein antibody (PE-Cy3), C-type (calcium dependent antibody (PE-Cy3), carbohydrate-recognition domain) lectin antibody (PE-Cy3), superfamily member 11 antibody (PE-Cy3), C-type (calcium dependent antibody (PE-Cy3), carbohydrate-recognition domain) lectin antibody (PE-Cy3), superfamily member 7 antibody (PE-Cy3), C-type lectin domain family 4 member C antibody (PE-Cy3), C-type lectin domain family 4 antibody (PE-Cy3), member C antibody (PE-Cy3), isoform 1 antibody (PE-Cy3), C-type lectin superfamily member 7 antibody (PE-Cy3), CD303 antibody (PE-Cy3), CD303 antigen antibody (PE-Cy3), CLECSF11 antibody (PE-Cy3), CLECSF7 antibody (PE-Cy3), Dendritic cell lectin antibody (PE-Cy3), dendritic cell lectin b antibody (PE-Cy3), Dendritic lectin antibody (PE-Cy3), DLEC antibody (PE-Cy3), HECL antibody (PE-Cy3), Lectin antibody (PE-Cy3), C-type antibody (PE-Cy3), superfamily member 11 antibody (PE-Cy3), MGC125789 antibody (PE-Cy3), MGC125791 antibody (PE-Cy3), MGC125792 antibody (PE-Cy3), MGC125793 antibody (PE-Cy3), PRO34150 antibody (PE-Cy3).3870Synthetic peptide (Please contact us for more details)orb129830100 ulCD303 antibody (PE-Cy5)BDCA-2 antibody (PE-Cy5), CLEC4C antibody (PE-Cy5), BDCA2 antibody (PE-Cy5), Blood dendritic cell antigen 2 antibody (PE-Cy5), Blood dendritic cell antigen 2 protein antibody (PE-Cy5), C-type (calcium dependent antibody (PE-Cy5), carbohydrate-recognition domain) lectin antibody (PE-Cy5), superfamily member 11 antibody (PE-Cy5), C-type (calcium dependent antibody (PE-Cy5), carbohydrate-recognition domain) lectin antibody (PE-Cy5), superfamily member 7 antibody (PE-Cy5), C-type lectin domain family 4 member C antibody (PE-Cy5), C-type lectin domain family 4 antibody (PE-Cy5), member C antibody (PE-Cy5), isoform 1 antibody (PE-Cy5), C-type lectin superfamily member 7 antibody (PE-Cy5), CD303 antibody (PE-Cy5), CD303 antigen antibody (PE-Cy5), CLECSF11 antibody (PE-Cy5), CLECSF7 antibody (PE-Cy5), Dendritic cell lectin antibody (PE-Cy5), dendritic cell lectin b antibody (PE-Cy5), Dendritic lectin antibody (PE-Cy5), DLEC antibody (PE-Cy5), HECL antibody (PE-Cy5), Lectin antibody (PE-Cy5), C-type antibody (PE-Cy5), superfamily member 11 antibody (PE-Cy5), MGC125789 antibody (PE-Cy5), MGC125791 antibody (PE-Cy5), MGC125792 antibody (PE-Cy5), MGC125793 antibody (PE-Cy5), PRO34150 antibody (PE-Cy5).3870Synthetic peptide (Please contact us for more details)orb130322100 ulCD303 antibody (PE-Cy5.5)BDCA-2 antibody (PE-Cy5.5), CLEC4C antibody (PE-Cy5.5), BDCA2 antibody (PE-Cy5.5), Blood dendritic cell antigen 2 antibody (PE-Cy5.5), Blood dendritic cell antigen 2 protein antibody (PE-Cy5.5), C-type (calcium dependent antibody (PE-Cy5.5), carbohydrate-recognition domain) lectin antibody (PE-Cy5.5), superfamily member 11 antibody (PE-Cy5.5), C-type (calcium dependent antibody (PE-Cy5.5), carbohydrate-recognition domain) lectin antibody (PE-Cy5.5), superfamily member 7 antibody (PE-Cy5.5), C-type lectin domain family 4 member C antibody (PE-Cy5.5), C-type lectin domain family 4 antibody (PE-Cy5.5), member C antibody (PE-Cy5.5), isoform 1 antibody (PE-Cy5.5), C-type lectin superfamily member 7 antibody (PE-Cy5.5), CD303 antibody (PE-Cy5.5), CD303 antigen antibody (PE-Cy5.5), CLECSF11 antibody (PE-Cy5.5), CLECSF7 antibody (PE-Cy5.5), Dendritic cell lectin antibody (PE-Cy5.5), dendritic cell lectin b antibody (PE-Cy5.5), Dendritic lectin antibody (PE-Cy5.5), DLEC antibody (PE-Cy5.5), HECL antibody (PE-Cy5.5), Lectin antibody (PE-Cy5.5), C-type antibody (PE-Cy5.5), superfamily member 11 antibody (PE-Cy5.5), MGC125789 antibody (PE-Cy5.5), MGC125791 antibody (PE-Cy5.5), MGC125792 antibody (PE-Cy5.5), MGC125793 antibody (PE-Cy5.5), PRO34150 antibody (PE-Cy5.5).3870Synthetic peptide (Please contact us for more details)orb130814100 ulCD303 antibody (PE-Cy7)BDCA-2 antibody (PE-Cy7), CLEC4C antibody (PE-Cy7), BDCA2 antibody (PE-Cy7), Blood dendritic cell antigen 2 antibody (PE-Cy7), Blood dendritic cell antigen 2 protein antibody (PE-Cy7), C-type (calcium dependent antibody (PE-Cy7), carbohydrate-recognition domain) lectin antibody (PE-Cy7), superfamily member 11 antibody (PE-Cy7), C-type (calcium dependent antibody (PE-Cy7), carbohydrate-recognition domain) lectin antibody (PE-Cy7), superfamily member 7 antibody (PE-Cy7), C-type lectin domain family 4 member C antibody (PE-Cy7), C-type lectin domain family 4 antibody (PE-Cy7), member C antibody (PE-Cy7), isoform 1 antibody (PE-Cy7), C-type lectin superfamily member 7 antibody (PE-Cy7), CD303 antibody (PE-Cy7), CD303 antigen antibody (PE-Cy7), CLECSF11 antibody (PE-Cy7), CLECSF7 antibody (PE-Cy7), Dendritic cell lectin antibody (PE-Cy7), dendritic cell lectin b antibody (PE-Cy7), Dendritic lectin antibody (PE-Cy7), DLEC antibody (PE-Cy7), HECL antibody (PE-Cy7), Lectin antibody (PE-Cy7), C-type antibody (PE-Cy7), superfamily member 11 antibody (PE-Cy7), MGC125789 antibody (PE-Cy7), MGC125791 antibody (PE-Cy7), MGC125792 antibody (PE-Cy7), MGC125793 antibody (PE-Cy7), PRO34150 antibody (PE-Cy7).3870Synthetic peptide (Please contact us for more details)orb131306100 ulCD303 antibody (RBITC)BDCA-2 antibody (RBITC), CLEC4C antibody (RBITC), BDCA2 antibody (RBITC), Blood dendritic cell antigen 2 antibody (RBITC), Blood dendritic cell antigen 2 protein antibody (RBITC), C-type (calcium dependent antibody (RBITC), carbohydrate-recognition domain) lectin antibody (RBITC), superfamily member 11 antibody (RBITC), C-type (calcium dependent antibody (RBITC), carbohydrate-recognition domain) lectin antibody (RBITC), superfamily member 7 antibody (RBITC), C-type lectin domain family 4 member C antibody (RBITC), C-type lectin domain family 4 antibody (RBITC), member C antibody (RBITC), isoform 1 antibody (RBITC), C-type lectin superfamily member 7 antibody (RBITC), CD303 antibody (RBITC), CD303 antigen antibody (RBITC), CLECSF11 antibody (RBITC), CLECSF7 antibody (RBITC), Dendritic cell lectin antibody (RBITC), dendritic cell lectin b antibody (RBITC), Dendritic lectin antibody (RBITC), DLEC antibody (RBITC), HECL antibody (RBITC), Lectin antibody (RBITC), C-type antibody (RBITC), superfamily member 11 antibody (RBITC), MGC125789 antibody (RBITC), MGC125791 antibody (RBITC), MGC125792 antibody (RBITC), MGC125793 antibody (RBITC), PRO34150 antibody (RBITC).3870Synthetic peptide (Please contact us for more details)orb11167100 ugCd304/Bdca-4/Nrp-1 antibodyanti-Bdca-4 antibody, anti-Nrp-1 antibody, anti-BDCA-4 antibody, anti-CD304 antibody, anti-DKFZp686A03134 antibody, anti-DKFZp781F1414 antibody, anti-NEL like protein 1 antibody, anti-Nel related protein 1 antibody, anti-Neuropilin1 antibody, anti-Neuropilin1 transmembrane receptor antibody, anti-NP1 antibody, anti-NRP antibody, anti-NRP1 antibody, anti-VEGF165R antibody3330orb11167200 ugCd304/Bdca-4/Nrp-1 antibodyanti-Bdca-4 antibody, anti-Nrp-1 antibody, anti-BDCA-4 antibody, anti-CD304 antibody, anti-DKFZp686A03134 antibody, anti-DKFZp781F1414 antibody, anti-NEL like protein 1 antibody, anti-Nel related protein 1 antibody, anti-Neuropilin1 antibody, anti-Neuropilin1 transmembrane receptor antibody, anti-NP1 antibody, anti-NRP antibody, anti-NRP1 antibody, anti-VEGF165R antibody4500orb1544120.1 mgCD305 antibody3690Activated NK cells and CD3- thymocytesorb311539100 ulCD305 antibody4716KLH Conjugated synthetic peptideorb8855350 ugCD305 antibodyanti LAIR-1 antibody6660orb9642450 ugCD305 antibodyanti LAIR-1 antibody6660Synthetic peptide C-NDTEDVSQASPSE from an internal region of human LAIR1/LAIR-1orb154531100 TestsCD305 antibody (PE )5670Activated NK cells and CD3- thymocytesorb315798200 ulCD306 antibodyanti CD306 antibody, anti Leukocyte-associated immunoglobulin-like receptor 2 antibody, anti LAIR-2 antibody, anti CD306 antibody4320KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD306. The exact sequence is proprietary.orb315798100 ulCD306 antibodyanti CD306 antibody, anti Leukocyte-associated immunoglobulin-like receptor 2 antibody, anti LAIR-2 antibody, anti CD306 antibody3060KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD306. The exact sequence is proprietary.orb311216100 ulCD307 antibody4716KLH Conjugated synthetic peptideorb140642200 ugCD307a antibodyanti FCRL1 antibody6030orb140642100 ugCD307a antibodyanti FCRL1 antibody4680orb14064250 ugCD307a antibodyanti FCRL1 antibody3420orb256534200 ulCD307e antibodyanti FCRH5 antibody, anti IRTA2 antibody, anti Fc receptor-like protein 5 antibody, anti FcR-like protein 5 antibody, anti FcRL5 antibody, anti BXMAS1 antibody, anti Fc receptor homolog 5 antibody, anti FcRH5 antibody, anti Immune receptor translocation-associated protein 2 antibody, anti CD307e antibody4410KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD307e. The exact sequence is proprietary.orb256534100 ulCD307e antibodyanti FCRH5 antibody, anti IRTA2 antibody, anti Fc receptor-like protein 5 antibody, anti FcR-like protein 5 antibody, anti FcRL5 antibody, anti BXMAS1 antibody, anti Fc receptor homolog 5 antibody, anti FcRH5 antibody, anti Immune receptor translocation-associated protein 2 antibody, anti CD307e antibody2970KLH-conjugated synthetic peptide encompassing a sequence within the center region of human CD307e. The exact sequence is proprietary.orb160321100 ugCD30-L antibody2970Synthesized peptide derived from the Internal region of human CD30-L.orb311527100 ulCD30-L antibody4716KLH Conjugated synthetic peptideorb193054100 ulCD31 (phospho-713) antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4716Synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-Y(p)-S-E).orb127131100 ugCD31 (phospho-Tyr713) antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2880Synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).orb127131200 ugCD31 (phospho-Tyr713) antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4140Synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).orb191779100 ulCD31 (Phospho-Tyr713) antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4716Peptide sequence around phosphorylation site of Tyrosine 713(T-V-Y(p)-S-E) derived from Human PECAM-1.orb214378200 ulCD31 (phospho-Y713) antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody5040orb214378100 ulCD31 (phospho-Y713) antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3420orb439850.1 mgCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3690orb1696330.5 mgCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3996Enriched human plateletsorb1696331 mgCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6840Enriched human plateletsorb272561 mlCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody5598Spleen cell membrane preparation of hairy cell leukaemia affected patientorb3018431 mlCD31 antibody12330orb3018651 mlCD31 antibody5850orb3018731 mlCD31 antibodyanti PECAM-1 antibody7290orb3019151 mlCD31 antibodyanti PECAM-1 antibody10080orb3021451 mlCD31 antibody8550orb3027651 mlCD31 antibody14310orb3720331 mlCD31 antibody8100orb43421100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3438orb160322100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2970Synthesized peptide derived from the Internal region of human CD31.orb160323100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2970Synthesized peptide derived from human CD31 around the non-phosphorylation site of Y713.orb196264100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4860E.coli-derived human CD31 recombinant proteinorb258052100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4500Synthetic peptideorb258807100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4500Synthetic peptideorb334956100 ugCD31 antibodyAnti-CD31/endoCAM antibody, Anti-endoCAM antibody, Anti-PECA1 antibody, Anti-PECAM1 antibody, Anti-PECAM-1 antibody, Anti-platelet/endothelial adhesion molecule 1 antibody.2970Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli.orb389179100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Recombinant human full-length CD31 proteinorb389180100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Human recombinant CD31 proteinorb389181100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Human recombinant CD31 proteinorb389182100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Human recombinant CD31 proteinorb389183100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Human recombinant CD31 protein (C31.3) & Membrane preparation of a spleen from a patient with hairy cell leukemia (JC/70A)orb389184100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Membrane preparation of a spleen from a patient with hairy cell leukemiaorb389185100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Membrane preparation of a spleen from a patient with hairy cell leukemiaorb389186100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Recombinant human CD31 proteinorb389187100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Stimulated human leukocytes (Workshop VI)orb389188100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4356Human recombinant CD31 proteinorb389189100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4158Human recombinant full-length CD31 proteinorb10314100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3330orb10314200 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4500orb221348100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3330orb221348200 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4500orb317588100 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody2970KLH conjugated synthetic peptide derived from mouse CD31orb317588200 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody3870KLH conjugated synthetic peptide derived from mouse CD31orb317589100 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody2970KLH conjugated synthetic peptide derived from rat CD31orb317589200 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody3870KLH conjugated synthetic peptide derived from rat CD31orb317590100 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody2970KLH conjugated synthetic peptide derived from human CD31orb317590200 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody3870KLH conjugated synthetic peptide derived from human CD31orb317592100 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody2970KLH conjugated synthetic peptide derived from human CD31orb317592200 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_HUMAN antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody3870KLH conjugated synthetic peptide derived from human CD31orb317600100 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_MOUSE antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody2970KLH conjugated synthetic peptide derived from mouse CD31orb317600200 ugCD31 antibodyanti platelet endothelial cell adhesion molecule precursor-1 antibody, anti PECAM-1 antibody, anti PECAM1 antibody, anti Adhesion molecule antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti Pecam 1 antibody, anti PECA1_MOUSE antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECA1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule antibody3870KLH conjugated synthetic peptide derived from mouse CD31orb126698100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2880Synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).orb126698200 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4140Synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).orb12020100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2700orb12020500 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody5040orb66671100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6948middle region of mouse CD31orb66672100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6948C-terminal region of mouse CD31orb97581100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3960Purified recombinant fragment of human CD31 expressed in E. Coli.orb131821100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6948C-terminal region of mouse CD31orb254651100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4716KLH conjugated synthetic peptideorb310240100 ulCD31 antibody4716KLH Conjugated synthetic peptideorb378645100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4230Synthetic peptideorb379335100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4230Synthetic peptideorb387853100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody5994C-terminal region of mouse CD31 or the middle region of human CD31orb387854100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6948C-terminal region of human CD31orb387855100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6948middle region of human CD31orb302533100 ulCD31 antibodyanti PECAM-1 antibody6300orb3025331 mlCD31 antibodyanti PECAM-1 antibody14490orb394577100 ulCD31 antibody3798Recombinant fragment of human CD31 expressed in E. Coliorb39457750 ulCD31 antibody3258Recombinant fragment of human CD31 expressed in E. Coliorb224393100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3798A synthesized peptide derived from human CD31orb22439320 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2736A synthesized peptide derived from human CD31orb22439350 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3258A synthesized peptide derived from human CD31orb227765100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3798A synthesized peptide derived from human CD31orb22776520 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2736A synthesized peptide derived from human CD31orb22776550 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3258A synthesized peptide derived from human CD31orb228963100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3798A synthetic peptide of human CD31orb22896320 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2736A synthetic peptide of human CD31orb22896350 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3258A synthetic peptide of human CD31orb229364100 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3798A synthetic peptide of human CD31orb22936420 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody2736A synthetic peptide of human CD31orb22936450 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3258A synthetic peptide of human CD31orb43990100 testsCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody5670orb94446125 ulCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6660orb3025302 mlCD31 antibody10710orb5603920 ugCD31 antibody3960Human recombinant PECAM-1 / CD31 protein was used as the immunogen for this antibody.orb56039100 ugCD31 antibody5850Human recombinant PECAM-1 / CD31 protein was used as the immunogen for this antibody.orb5604120 ugCD31 antibody3960Recombinant human proteinorb56041100 ugCD31 antibody5850Recombinant human proteinorb5616020 ugCD31 antibody3960Recombinant human protein was used as the immunogen for the CD31 antibody.orb56160100 ugCD31 antibody5850Recombinant human protein was used as the immunogen for the CD31 antibody.orb5628320 ugCD31 antibody3960A membrane preparation of a spleen from a patient with hairy cell leukemia was used as the immunogen for this CD31 antibody.orb56283100 ugCD31 antibody5850A membrane preparation of a spleen from a patient with hairy cell leukemia was used as the immunogen for this CD31 antibody.orb5629020 ugCD31 antibody3960Human full length recombinant protein was used as the immunogen for this CD31 antibody.orb56290100 ugCD31 antibody5850Human full length recombinant protein was used as the immunogen for this CD31 antibody.orb5629620 ugCD31 antibody3960Human protein was used as the immunogen for the CD31 antibody.orb56296100 ugCD31 antibody5850Human protein was used as the immunogen for the CD31 antibody.orb5640020 ugCD31 antibody3960Recombinant human protein was used as the immunogen for this CD31 antibody.orb56400100 ugCD31 antibody5850Recombinant human protein was used as the immunogen for this CD31 antibody.orb5646020 ugCD31 antibody4500A full length recombinant human protein was used as the immunogen for the rabbit monoclonal CD31 antibody.orb56460100 ugCD31 antibody6570A full length recombinant human protein was used as the immunogen for the rabbit monoclonal CD31 antibody.orb5647120 ugCD31 antibody4500Human full length recombinant protein was used as the immunogen for the recombinant CD31 antibody.orb56471100 ugCD31 antibody6570Human full length recombinant protein was used as the immunogen for the recombinant CD31 antibody.orb5649220 ugCD31 antibody3960Human recombinant protein was used as the immunogen for this anti-CD31 antibody.orb56492100 ugCD31 antibody5850Human recombinant protein was used as the immunogen for this anti-CD31 antibody.orb308329200 ugCD31 antibodyanti CD31 antibody, anti PECAM-1 antibody3780Recombinant human CD31orb308388200 ugCD31 antibodyanti CD31 antibody, anti PECAM-1 antibody3780Recombinant human CD31orb170382200 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6030Recombinant Human CD31 protein. Produced in rabbits immunized with purified, recombinant Human CD31/PECAM1orb17038250 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3420Recombinant Human CD31 protein. Produced in rabbits immunized with purified, recombinant Human CD31/PECAM1orb170382100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4680Recombinant Human CD31 protein. Produced in rabbits immunized with purified, recombinant Human CD31/PECAM1orb170447200 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6030Recombinant Human CD31 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD31/PECAM1 extracellular domainorb17044750 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3420Recombinant Human CD31 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD31/PECAM1 extracellular domainorb170447100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody4680Recombinant Human CD31 protein. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD31/PECAM1 extracellular domainorb230023200 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody6030orb23002350 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion molecule 1 antibody, anti Platelet/endothelial cell adhesion molecule antibody3420orb230023100 ugCD31 antibodyanti Adhesion molecule antibody, anti CD31 antibody, anti CD31 antigen antibody, anti CD31 EndoCAM antibody, anti Endocam antibody, anti FLJ34100 antibody, anti FLJ58394 antibody, anti GPIIA antibody, anti GPIIA' antibody, anti PECA1 antibody, anti PECA1_HUMAN antibody, anti Pecam 1 antibody, anti PECAM 1 CD31 EndoCAM antibody, anti PECAM antibody, anti PECAM-1 antibody, anti Pecam1 antibody, anti Platelet endothelial cell adhesion molecule antibody, anti Platelet/endothelial cell adhesion mol